Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q8SRY0

Protein Details
Accession Q8SRY0    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-101DAGYRCRRKGVRRRKSVRGSIVBasic
163-194SECDDPKKIPKIRHNGKRMKREQERREQIMKIBasic
NLS Segment(s)
PositionSequence
82-95GYRCRRKGVRRRKS
169-200KKIPKIRHNGKRMKREQERREQIMKIRLERKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ecu:ECU05_0670  -  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNIAYPTNGTQKMFEIERRNEVRLYDKKIGDQFDGGILGEEFEGTIMEITGGDDYQGFPMVSGHLTKKRVRPLLSKGDAGYRCRRKGVRRRKSVRGSIVSEEICVLNLIILRPGEKEIDGLTNAVNDVSHLPRKEKKLRKMFGVPDEEKNVVGYIRNILKSECDDPKKIPKIRHNGKRMKREQERREQIMKIRLERKRILEEERKEYLEKYFNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.34
4 0.36
5 0.38
6 0.46
7 0.49
8 0.49
9 0.46
10 0.45
11 0.47
12 0.46
13 0.5
14 0.48
15 0.46
16 0.49
17 0.52
18 0.53
19 0.46
20 0.39
21 0.31
22 0.24
23 0.23
24 0.18
25 0.14
26 0.1
27 0.09
28 0.07
29 0.07
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.07
46 0.06
47 0.06
48 0.07
49 0.07
50 0.08
51 0.1
52 0.13
53 0.18
54 0.22
55 0.27
56 0.33
57 0.4
58 0.46
59 0.48
60 0.5
61 0.53
62 0.59
63 0.57
64 0.53
65 0.45
66 0.47
67 0.46
68 0.43
69 0.45
70 0.42
71 0.41
72 0.44
73 0.49
74 0.51
75 0.59
76 0.66
77 0.67
78 0.7
79 0.76
80 0.81
81 0.84
82 0.82
83 0.79
84 0.73
85 0.66
86 0.57
87 0.53
88 0.43
89 0.34
90 0.27
91 0.19
92 0.14
93 0.1
94 0.07
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.07
113 0.06
114 0.05
115 0.04
116 0.06
117 0.09
118 0.13
119 0.13
120 0.18
121 0.23
122 0.31
123 0.41
124 0.49
125 0.56
126 0.63
127 0.66
128 0.68
129 0.71
130 0.7
131 0.67
132 0.67
133 0.59
134 0.53
135 0.52
136 0.46
137 0.38
138 0.32
139 0.25
140 0.16
141 0.14
142 0.11
143 0.13
144 0.16
145 0.17
146 0.17
147 0.17
148 0.19
149 0.22
150 0.27
151 0.3
152 0.31
153 0.32
154 0.36
155 0.46
156 0.53
157 0.55
158 0.59
159 0.6
160 0.66
161 0.74
162 0.8
163 0.8
164 0.81
165 0.85
166 0.88
167 0.87
168 0.87
169 0.87
170 0.88
171 0.87
172 0.88
173 0.88
174 0.85
175 0.82
176 0.76
177 0.72
178 0.7
179 0.66
180 0.64
181 0.64
182 0.61
183 0.63
184 0.64
185 0.63
186 0.64
187 0.63
188 0.63
189 0.64
190 0.66
191 0.66
192 0.65
193 0.62
194 0.54
195 0.5
196 0.48
197 0.47