Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3WKB1

Protein Details
Accession A0A5E3WKB1    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
399-424RETPAPPQPPRRPSRLRRIVRSMFFGHydrophilic
NLS Segment(s)
PositionSequence
146-149ARRK
185-190RGKRRR
407-436PPRRPSRLRRIVRSMFFGGRAIGPPPKGKS
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MKLNDDPMTRPRVLNREWTGRKPSLSKATSLPVLALVPDNRPLFTCAKCGFTNRYPIVPICLFCAWTTPEAIAAFESALSRVRRRRISGPAPAPVSNATPDAIKYDAKCGKLNSNGGTFTKDTESMQIVASLDRVVAIGRGNIARARRKRLPHPCLPPPTTTKSARTPESAGSGAKPADAMAGSRGKRRRPEGFDSAHLGGDDRPSTAPQPAPSLAPPEMAARMRKRSSQSLRDRSPPSTIKRSAPPSSSGIPSSQTSRAPSPEPRLGSTERPYYTAIRKNMSRPTTPFIPTPSSSPPPAAYMPTRMSAENASSPEPSPNMRPSADYMGTTRISPEFGGHVVRPSADYATYSRMSGSSSLPPRRPGGSVSGEMELRMALAARRSEEGPPAGARQEYVFRETPAPPQPPRRPSRLRRIVRSMFFGGRAIGPPPKGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.58
4 0.62
5 0.66
6 0.68
7 0.64
8 0.66
9 0.61
10 0.62
11 0.61
12 0.56
13 0.52
14 0.48
15 0.49
16 0.46
17 0.42
18 0.34
19 0.25
20 0.23
21 0.2
22 0.2
23 0.16
24 0.16
25 0.22
26 0.23
27 0.22
28 0.23
29 0.26
30 0.26
31 0.26
32 0.32
33 0.28
34 0.32
35 0.33
36 0.37
37 0.41
38 0.41
39 0.49
40 0.44
41 0.45
42 0.43
43 0.42
44 0.44
45 0.38
46 0.34
47 0.28
48 0.27
49 0.25
50 0.22
51 0.25
52 0.2
53 0.19
54 0.19
55 0.15
56 0.16
57 0.15
58 0.16
59 0.12
60 0.1
61 0.09
62 0.09
63 0.09
64 0.07
65 0.12
66 0.15
67 0.21
68 0.27
69 0.35
70 0.41
71 0.46
72 0.53
73 0.58
74 0.63
75 0.67
76 0.66
77 0.65
78 0.62
79 0.57
80 0.52
81 0.43
82 0.36
83 0.27
84 0.22
85 0.16
86 0.13
87 0.13
88 0.13
89 0.14
90 0.14
91 0.14
92 0.22
93 0.26
94 0.28
95 0.31
96 0.31
97 0.36
98 0.4
99 0.43
100 0.38
101 0.36
102 0.36
103 0.34
104 0.35
105 0.29
106 0.25
107 0.22
108 0.2
109 0.17
110 0.18
111 0.19
112 0.16
113 0.16
114 0.15
115 0.13
116 0.12
117 0.12
118 0.09
119 0.07
120 0.06
121 0.06
122 0.05
123 0.05
124 0.06
125 0.05
126 0.07
127 0.08
128 0.09
129 0.11
130 0.16
131 0.24
132 0.29
133 0.37
134 0.42
135 0.49
136 0.58
137 0.67
138 0.7
139 0.7
140 0.74
141 0.74
142 0.76
143 0.72
144 0.66
145 0.61
146 0.58
147 0.55
148 0.5
149 0.46
150 0.45
151 0.47
152 0.45
153 0.43
154 0.39
155 0.34
156 0.34
157 0.31
158 0.23
159 0.19
160 0.19
161 0.16
162 0.13
163 0.11
164 0.08
165 0.07
166 0.07
167 0.06
168 0.07
169 0.13
170 0.14
171 0.21
172 0.25
173 0.29
174 0.35
175 0.41
176 0.46
177 0.47
178 0.54
179 0.55
180 0.54
181 0.52
182 0.51
183 0.46
184 0.38
185 0.3
186 0.24
187 0.16
188 0.15
189 0.12
190 0.08
191 0.08
192 0.08
193 0.1
194 0.11
195 0.12
196 0.11
197 0.14
198 0.14
199 0.15
200 0.14
201 0.17
202 0.15
203 0.14
204 0.14
205 0.12
206 0.13
207 0.14
208 0.18
209 0.17
210 0.23
211 0.24
212 0.27
213 0.3
214 0.38
215 0.44
216 0.49
217 0.57
218 0.6
219 0.62
220 0.65
221 0.65
222 0.57
223 0.56
224 0.52
225 0.47
226 0.46
227 0.46
228 0.42
229 0.46
230 0.5
231 0.47
232 0.43
233 0.41
234 0.36
235 0.35
236 0.33
237 0.28
238 0.22
239 0.21
240 0.2
241 0.2
242 0.19
243 0.18
244 0.19
245 0.2
246 0.22
247 0.23
248 0.27
249 0.3
250 0.32
251 0.32
252 0.31
253 0.34
254 0.34
255 0.36
256 0.36
257 0.36
258 0.31
259 0.31
260 0.32
261 0.31
262 0.36
263 0.38
264 0.37
265 0.35
266 0.38
267 0.41
268 0.47
269 0.48
270 0.45
271 0.41
272 0.43
273 0.44
274 0.43
275 0.4
276 0.35
277 0.36
278 0.33
279 0.33
280 0.33
281 0.31
282 0.3
283 0.29
284 0.26
285 0.25
286 0.25
287 0.24
288 0.2
289 0.22
290 0.23
291 0.24
292 0.24
293 0.21
294 0.21
295 0.19
296 0.2
297 0.19
298 0.19
299 0.18
300 0.18
301 0.18
302 0.19
303 0.19
304 0.19
305 0.2
306 0.22
307 0.24
308 0.23
309 0.24
310 0.26
311 0.31
312 0.31
313 0.27
314 0.25
315 0.25
316 0.25
317 0.24
318 0.22
319 0.15
320 0.15
321 0.14
322 0.14
323 0.11
324 0.12
325 0.15
326 0.14
327 0.16
328 0.15
329 0.15
330 0.15
331 0.15
332 0.15
333 0.12
334 0.13
335 0.13
336 0.18
337 0.18
338 0.17
339 0.16
340 0.16
341 0.17
342 0.17
343 0.18
344 0.21
345 0.29
346 0.37
347 0.39
348 0.43
349 0.44
350 0.45
351 0.43
352 0.37
353 0.36
354 0.34
355 0.34
356 0.32
357 0.32
358 0.29
359 0.28
360 0.25
361 0.18
362 0.12
363 0.09
364 0.08
365 0.06
366 0.11
367 0.13
368 0.14
369 0.17
370 0.18
371 0.2
372 0.24
373 0.25
374 0.24
375 0.24
376 0.25
377 0.25
378 0.23
379 0.22
380 0.2
381 0.25
382 0.25
383 0.28
384 0.28
385 0.28
386 0.32
387 0.33
388 0.38
389 0.4
390 0.44
391 0.45
392 0.54
393 0.62
394 0.67
395 0.72
396 0.75
397 0.77
398 0.8
399 0.84
400 0.85
401 0.85
402 0.84
403 0.88
404 0.87
405 0.81
406 0.79
407 0.73
408 0.65
409 0.57
410 0.48
411 0.4
412 0.33
413 0.3
414 0.27
415 0.26
416 0.27