Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VFI2

Protein Details
Accession H1VFI2    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
5-24PDPARLRRQEPESRRRQRHABasic
NLS Segment(s)
PositionSequence
2-31RRRPDPARLRRQEPESRRRQRHAHGSRRQH
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences RRRRPDPARLRRQEPESRRRQRHAHGSRRQHVPAYLRPGREGRGDHQARHLNQSNDRGLEKNCRCFLSLVCFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.77
4 0.8
5 0.81
6 0.8
7 0.79
8 0.77
9 0.79
10 0.79
11 0.78
12 0.77
13 0.79
14 0.8
15 0.79
16 0.72
17 0.62
18 0.55
19 0.49
20 0.45
21 0.44
22 0.4
23 0.34
24 0.35
25 0.34
26 0.33
27 0.31
28 0.28
29 0.22
30 0.29
31 0.3
32 0.29
33 0.36
34 0.41
35 0.38
36 0.44
37 0.47
38 0.41
39 0.44
40 0.49
41 0.45
42 0.41
43 0.41
44 0.36
45 0.33
46 0.4
47 0.41
48 0.44
49 0.44
50 0.44
51 0.44
52 0.43
53 0.43