Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q8SRH8

Protein Details
Accession Q8SRH8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
107-129AAEKCRKCFSKDLRLKKPLKAMKHydrophilic
NLS Segment(s)
PositionSequence
120-131RLKKPLKAMKKK
Subcellular Location(s) mito 16, cyto_mito 10.833, mito_nucl 10.833, nucl 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ecu:ECU07_1380  -  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MQIGVRFCGKTSFVQAEPSQSVLSLKALVGRACGLDSSVMVLQHNSRILEDSGTMAGYGMRTLDTITAYPKLLGGGGNMSDNDAAMAMKEKNDCLICRRCYARSGKAAEKCRKCFSKDLRLKKPLKAMKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.34
4 0.33
5 0.32
6 0.26
7 0.21
8 0.21
9 0.16
10 0.16
11 0.11
12 0.1
13 0.12
14 0.14
15 0.14
16 0.14
17 0.14
18 0.13
19 0.12
20 0.12
21 0.09
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.09
29 0.09
30 0.11
31 0.13
32 0.11
33 0.1
34 0.12
35 0.12
36 0.12
37 0.12
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.05
44 0.05
45 0.04
46 0.04
47 0.03
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.07
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.06
68 0.06
69 0.05
70 0.05
71 0.04
72 0.03
73 0.06
74 0.06
75 0.08
76 0.09
77 0.09
78 0.13
79 0.15
80 0.16
81 0.21
82 0.29
83 0.3
84 0.35
85 0.38
86 0.37
87 0.42
88 0.48
89 0.49
90 0.48
91 0.52
92 0.55
93 0.6
94 0.68
95 0.71
96 0.73
97 0.71
98 0.73
99 0.72
100 0.68
101 0.7
102 0.69
103 0.7
104 0.71
105 0.76
106 0.78
107 0.82
108 0.82
109 0.79
110 0.8
111 0.78