Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3X0B9

Protein Details
Accession A0A5E3X0B9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
38-57LAVPKKKVSHSRKNMRSANKHydrophilic
NLS Segment(s)
PositionSequence
43-44KK
47-50HSRK
Subcellular Location(s) mito 17.5, cyto_mito 10, extr 5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MASSLTRLSLAASLAPGSLAWTSPSLGSLLELFPPWLLAVPKKKVSHSRKNMRSANKGLKDKHNIVNCPGCGAAKLSHHLGCSVDGGSEPNAGMILHIRTHSRHSLVPRICFAVTPCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.08
5 0.07
6 0.07
7 0.08
8 0.08
9 0.09
10 0.09
11 0.1
12 0.08
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.12
26 0.19
27 0.24
28 0.31
29 0.32
30 0.37
31 0.45
32 0.54
33 0.59
34 0.63
35 0.69
36 0.7
37 0.78
38 0.8
39 0.77
40 0.74
41 0.71
42 0.69
43 0.66
44 0.64
45 0.58
46 0.58
47 0.57
48 0.55
49 0.54
50 0.5
51 0.43
52 0.41
53 0.43
54 0.36
55 0.31
56 0.27
57 0.21
58 0.16
59 0.16
60 0.15
61 0.12
62 0.14
63 0.16
64 0.17
65 0.17
66 0.18
67 0.16
68 0.15
69 0.14
70 0.12
71 0.09
72 0.08
73 0.09
74 0.09
75 0.09
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.09
83 0.09
84 0.11
85 0.13
86 0.14
87 0.2
88 0.24
89 0.25
90 0.28
91 0.33
92 0.42
93 0.46
94 0.49
95 0.47
96 0.46
97 0.43
98 0.4