Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W3D9

Protein Details
Accession H1W3D9   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRCGKKKKEEENKKREIHVVBasic
NLS Segment(s)
PositionSequence
6-10KKKKE
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MKRCGKKKKEEENKKREIHVVVVDLYGSLHSSFPFSQDNFGIETDKTSDEKRPMDLRDSKDFFLPGMPRKPKGVLKEEDQTNKTGTCSSRLSFINSKRVVTTCIIGISDRPTSLGATRRLAPQKARQYIAQGGRSNTASVRASSLGECAWRSTPNPGAHRSTQQAVHDVWERGGSVKLRSACMRHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.81
3 0.75
4 0.66
5 0.59
6 0.52
7 0.45
8 0.35
9 0.3
10 0.26
11 0.2
12 0.18
13 0.13
14 0.09
15 0.07
16 0.07
17 0.07
18 0.1
19 0.1
20 0.13
21 0.17
22 0.17
23 0.19
24 0.19
25 0.2
26 0.19
27 0.19
28 0.18
29 0.14
30 0.15
31 0.14
32 0.15
33 0.15
34 0.16
35 0.2
36 0.23
37 0.25
38 0.28
39 0.31
40 0.32
41 0.38
42 0.43
43 0.44
44 0.48
45 0.5
46 0.46
47 0.42
48 0.4
49 0.32
50 0.29
51 0.28
52 0.24
53 0.3
54 0.33
55 0.33
56 0.35
57 0.39
58 0.39
59 0.41
60 0.43
61 0.37
62 0.38
63 0.44
64 0.47
65 0.48
66 0.45
67 0.4
68 0.33
69 0.3
70 0.26
71 0.22
72 0.17
73 0.16
74 0.17
75 0.16
76 0.2
77 0.2
78 0.24
79 0.27
80 0.3
81 0.35
82 0.33
83 0.34
84 0.3
85 0.3
86 0.28
87 0.23
88 0.2
89 0.12
90 0.11
91 0.11
92 0.1
93 0.1
94 0.1
95 0.1
96 0.09
97 0.09
98 0.09
99 0.1
100 0.12
101 0.18
102 0.18
103 0.2
104 0.21
105 0.27
106 0.31
107 0.34
108 0.36
109 0.39
110 0.46
111 0.49
112 0.49
113 0.44
114 0.44
115 0.48
116 0.5
117 0.48
118 0.41
119 0.37
120 0.38
121 0.37
122 0.33
123 0.26
124 0.24
125 0.18
126 0.16
127 0.17
128 0.15
129 0.16
130 0.15
131 0.16
132 0.12
133 0.13
134 0.13
135 0.13
136 0.14
137 0.15
138 0.16
139 0.2
140 0.27
141 0.33
142 0.38
143 0.4
144 0.44
145 0.46
146 0.51
147 0.5
148 0.46
149 0.43
150 0.41
151 0.4
152 0.34
153 0.34
154 0.34
155 0.31
156 0.27
157 0.24
158 0.22
159 0.2
160 0.24
161 0.22
162 0.19
163 0.24
164 0.26
165 0.3
166 0.34