Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3X2Q1

Protein Details
Accession A0A5E3X2Q1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-117LGARKAARLRKKAGRSKLVNHydrophilic
NLS Segment(s)
PositionSequence
69-114ADAARRKEITLERRKAAEERKRAEELKAQLGARKAARLRKKAGRSK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSLPDPVPIASSFNGRTSGKPWKSQKAPTVRSHLQPGVKSKSWEDRMEKTKKAQAIKKLQDELKDEKQADAARRKEITLERRKAAEERKRAEELKAQLGARKAARLRKKAGRSKLVNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.24
4 0.26
5 0.36
6 0.36
7 0.44
8 0.49
9 0.54
10 0.6
11 0.66
12 0.69
13 0.69
14 0.72
15 0.69
16 0.71
17 0.65
18 0.62
19 0.61
20 0.57
21 0.5
22 0.47
23 0.47
24 0.45
25 0.43
26 0.41
27 0.38
28 0.43
29 0.43
30 0.45
31 0.43
32 0.44
33 0.5
34 0.54
35 0.53
36 0.48
37 0.47
38 0.46
39 0.48
40 0.45
41 0.46
42 0.5
43 0.54
44 0.55
45 0.55
46 0.52
47 0.49
48 0.49
49 0.46
50 0.41
51 0.4
52 0.35
53 0.31
54 0.32
55 0.32
56 0.33
57 0.35
58 0.32
59 0.31
60 0.32
61 0.32
62 0.33
63 0.37
64 0.41
65 0.44
66 0.47
67 0.45
68 0.46
69 0.48
70 0.49
71 0.52
72 0.51
73 0.5
74 0.5
75 0.54
76 0.57
77 0.57
78 0.54
79 0.51
80 0.46
81 0.44
82 0.43
83 0.38
84 0.36
85 0.37
86 0.39
87 0.33
88 0.35
89 0.34
90 0.38
91 0.48
92 0.51
93 0.57
94 0.63
95 0.72
96 0.75
97 0.8
98 0.81