Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3XEH1

Protein Details
Accession A0A5E3XEH1    Localization Confidence High Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-49ESLPTPPSTIRKRPRTGSRSSHydrophilic
61-86DELPRPLSPEPSKKKRRIDEAGKAVAHydrophilic
95-120EEFWGPKRPAPKKRRAAAQGKRRSTTHydrophilic
NLS Segment(s)
PositionSequence
73-77KKKRR
100-127PKRPAPKKRRAAAQGKRRSTTRSKSPPK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MSAETTSVFPLVNPGKPSSLRRSHSVASESLPTPPSTIRKRPRTGSRSSVYSDDEDATAEDELPRPLSPEPSKKKRRIDEAGKAVASGGDETEEEEFWGPKRPAPKKRRAAAQGKRRSTTRSKSPPKVTDTASRRAAASTLLSPPPTRPRDPVTPPRRTFSKDKEAAKGKDKDIHPVRDSPNNPFLVALPADAAADSDAESDVEVPSSPLGPKTPLPELPTMTYVFRGKKQIFANPFYGAQPDPRATLSPRHPDYSPSEMCAPRRLFKPRSRSASSKLVPQSDKEKRAASPDPWDSEDEEGAGKPMPRLALVKEFAKARGEGAVARAHDSDDEAPVVEKRQASRSRSRSHHDEEEDDATVAAPTSDTVAPEAHSDGEDEPTPKAKKIARNGSSKASYRDGMVRSTSYVKKASSQSVSRSRSRSGEEWTAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.38
4 0.45
5 0.46
6 0.52
7 0.51
8 0.53
9 0.57
10 0.55
11 0.57
12 0.54
13 0.46
14 0.39
15 0.41
16 0.37
17 0.34
18 0.32
19 0.26
20 0.25
21 0.28
22 0.33
23 0.36
24 0.46
25 0.53
26 0.61
27 0.69
28 0.76
29 0.82
30 0.8
31 0.8
32 0.79
33 0.74
34 0.69
35 0.64
36 0.59
37 0.51
38 0.46
39 0.4
40 0.32
41 0.26
42 0.22
43 0.19
44 0.16
45 0.13
46 0.11
47 0.1
48 0.1
49 0.11
50 0.12
51 0.12
52 0.13
53 0.13
54 0.21
55 0.28
56 0.37
57 0.46
58 0.56
59 0.66
60 0.73
61 0.82
62 0.82
63 0.85
64 0.84
65 0.84
66 0.84
67 0.82
68 0.8
69 0.69
70 0.61
71 0.51
72 0.41
73 0.31
74 0.21
75 0.12
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.09
84 0.09
85 0.18
86 0.17
87 0.18
88 0.28
89 0.37
90 0.47
91 0.56
92 0.67
93 0.68
94 0.75
95 0.83
96 0.82
97 0.84
98 0.83
99 0.84
100 0.84
101 0.8
102 0.76
103 0.69
104 0.66
105 0.64
106 0.63
107 0.63
108 0.64
109 0.67
110 0.73
111 0.8
112 0.8
113 0.77
114 0.73
115 0.66
116 0.65
117 0.6
118 0.58
119 0.53
120 0.47
121 0.41
122 0.36
123 0.33
124 0.24
125 0.21
126 0.15
127 0.15
128 0.16
129 0.16
130 0.17
131 0.2
132 0.28
133 0.31
134 0.31
135 0.31
136 0.36
137 0.43
138 0.51
139 0.58
140 0.59
141 0.64
142 0.64
143 0.64
144 0.62
145 0.59
146 0.58
147 0.56
148 0.57
149 0.54
150 0.56
151 0.59
152 0.64
153 0.63
154 0.64
155 0.61
156 0.52
157 0.52
158 0.49
159 0.51
160 0.5
161 0.52
162 0.45
163 0.46
164 0.47
165 0.48
166 0.49
167 0.44
168 0.44
169 0.38
170 0.36
171 0.29
172 0.27
173 0.21
174 0.2
175 0.14
176 0.08
177 0.07
178 0.07
179 0.07
180 0.06
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.06
198 0.08
199 0.09
200 0.12
201 0.14
202 0.16
203 0.19
204 0.2
205 0.21
206 0.21
207 0.21
208 0.19
209 0.17
210 0.17
211 0.17
212 0.17
213 0.18
214 0.24
215 0.22
216 0.28
217 0.3
218 0.34
219 0.35
220 0.37
221 0.37
222 0.32
223 0.32
224 0.26
225 0.25
226 0.19
227 0.16
228 0.15
229 0.14
230 0.13
231 0.13
232 0.14
233 0.14
234 0.21
235 0.26
236 0.32
237 0.34
238 0.35
239 0.35
240 0.36
241 0.4
242 0.41
243 0.35
244 0.28
245 0.31
246 0.31
247 0.32
248 0.37
249 0.34
250 0.3
251 0.35
252 0.41
253 0.44
254 0.48
255 0.57
256 0.58
257 0.64
258 0.65
259 0.65
260 0.62
261 0.65
262 0.59
263 0.57
264 0.53
265 0.51
266 0.45
267 0.43
268 0.47
269 0.45
270 0.49
271 0.44
272 0.42
273 0.37
274 0.43
275 0.45
276 0.38
277 0.38
278 0.38
279 0.38
280 0.37
281 0.37
282 0.32
283 0.29
284 0.26
285 0.18
286 0.15
287 0.11
288 0.1
289 0.11
290 0.1
291 0.08
292 0.1
293 0.1
294 0.1
295 0.12
296 0.14
297 0.19
298 0.21
299 0.22
300 0.24
301 0.25
302 0.26
303 0.26
304 0.24
305 0.17
306 0.17
307 0.17
308 0.14
309 0.15
310 0.17
311 0.15
312 0.17
313 0.17
314 0.15
315 0.14
316 0.16
317 0.14
318 0.12
319 0.12
320 0.1
321 0.11
322 0.11
323 0.13
324 0.14
325 0.15
326 0.16
327 0.25
328 0.32
329 0.38
330 0.48
331 0.55
332 0.61
333 0.65
334 0.7
335 0.69
336 0.69
337 0.71
338 0.65
339 0.59
340 0.54
341 0.51
342 0.45
343 0.37
344 0.29
345 0.2
346 0.17
347 0.13
348 0.09
349 0.06
350 0.04
351 0.08
352 0.08
353 0.08
354 0.1
355 0.1
356 0.11
357 0.13
358 0.14
359 0.11
360 0.11
361 0.12
362 0.12
363 0.14
364 0.16
365 0.16
366 0.16
367 0.23
368 0.25
369 0.25
370 0.31
371 0.34
372 0.4
373 0.5
374 0.59
375 0.59
376 0.66
377 0.69
378 0.71
379 0.72
380 0.68
381 0.62
382 0.56
383 0.49
384 0.43
385 0.46
386 0.39
387 0.36
388 0.35
389 0.31
390 0.3
391 0.36
392 0.37
393 0.35
394 0.37
395 0.35
396 0.39
397 0.42
398 0.47
399 0.48
400 0.5
401 0.54
402 0.6
403 0.65
404 0.65
405 0.64
406 0.61
407 0.58
408 0.6
409 0.55
410 0.52
411 0.55