Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3X2K5

Protein Details
Accession A0A5E3X2K5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
13-35AAPPKFSDFRKKRRAAAAKSDDAHydrophilic
NLS Segment(s)
PositionSequence
22-26RKKRR
322-343KEKAGESAGKKKSGKKVSFKKD
Subcellular Location(s) plas 16, mito 7, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009580  GPI_biosynthesis_protein_Pig-F  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF06699  PIG-F  
Amino Acid Sequences MASIRAALRNVAAAPPKFSDFRKKRRAAAAKSDDASDSAVASGPYGFPTQYPAHVFFHGFLVLASLAMLPRTISLDPPPEQLRNLDKPQYPFIAPLTARPEITAAWVALGNAALVGWWSGSVREWVREGKMGLKMVDRLRDETHRKDISNAVVFTLYASLAYAFLIVLCGAPLATHLPHTLLLGLNLAILTVHVPAYALGPPRLPFRLPFVGSKQDRLDTNTTLILNNTWVRLFAERDARSPKERAIAYPAFGALTGAWLGVIPIGLDWDRPWQAYPLTPLIGAVFGYVFGAFFAVIVNMTLFLAAYDVEDDKSTASAAGSKEKAGESAGKKKSGKKVSFKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.31
4 0.32
5 0.35
6 0.42
7 0.45
8 0.54
9 0.62
10 0.65
11 0.7
12 0.77
13 0.84
14 0.81
15 0.82
16 0.8
17 0.77
18 0.72
19 0.65
20 0.55
21 0.45
22 0.38
23 0.27
24 0.18
25 0.11
26 0.11
27 0.09
28 0.09
29 0.09
30 0.07
31 0.09
32 0.1
33 0.09
34 0.08
35 0.14
36 0.15
37 0.19
38 0.23
39 0.25
40 0.26
41 0.28
42 0.29
43 0.24
44 0.25
45 0.2
46 0.16
47 0.12
48 0.11
49 0.09
50 0.08
51 0.08
52 0.06
53 0.06
54 0.06
55 0.06
56 0.04
57 0.05
58 0.08
59 0.08
60 0.1
61 0.13
62 0.19
63 0.2
64 0.25
65 0.28
66 0.27
67 0.28
68 0.3
69 0.34
70 0.35
71 0.39
72 0.42
73 0.42
74 0.44
75 0.47
76 0.46
77 0.39
78 0.34
79 0.3
80 0.3
81 0.25
82 0.26
83 0.28
84 0.26
85 0.25
86 0.24
87 0.23
88 0.17
89 0.19
90 0.16
91 0.1
92 0.09
93 0.09
94 0.09
95 0.08
96 0.08
97 0.06
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.02
104 0.03
105 0.03
106 0.03
107 0.04
108 0.08
109 0.09
110 0.11
111 0.13
112 0.15
113 0.16
114 0.18
115 0.18
116 0.18
117 0.21
118 0.21
119 0.2
120 0.2
121 0.23
122 0.23
123 0.28
124 0.25
125 0.24
126 0.26
127 0.32
128 0.36
129 0.36
130 0.42
131 0.39
132 0.38
133 0.38
134 0.38
135 0.35
136 0.35
137 0.3
138 0.22
139 0.2
140 0.19
141 0.17
142 0.14
143 0.09
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.02
158 0.02
159 0.03
160 0.04
161 0.04
162 0.05
163 0.05
164 0.06
165 0.07
166 0.07
167 0.07
168 0.06
169 0.06
170 0.06
171 0.06
172 0.05
173 0.04
174 0.04
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.05
184 0.07
185 0.08
186 0.08
187 0.1
188 0.11
189 0.13
190 0.15
191 0.14
192 0.13
193 0.18
194 0.23
195 0.24
196 0.26
197 0.28
198 0.36
199 0.36
200 0.39
201 0.35
202 0.31
203 0.3
204 0.32
205 0.32
206 0.24
207 0.25
208 0.23
209 0.22
210 0.2
211 0.19
212 0.15
213 0.14
214 0.14
215 0.13
216 0.1
217 0.1
218 0.11
219 0.13
220 0.14
221 0.15
222 0.23
223 0.23
224 0.27
225 0.33
226 0.35
227 0.37
228 0.38
229 0.36
230 0.34
231 0.34
232 0.31
233 0.33
234 0.32
235 0.29
236 0.27
237 0.25
238 0.18
239 0.17
240 0.16
241 0.08
242 0.07
243 0.06
244 0.05
245 0.05
246 0.04
247 0.04
248 0.04
249 0.04
250 0.03
251 0.03
252 0.05
253 0.05
254 0.06
255 0.06
256 0.12
257 0.13
258 0.14
259 0.15
260 0.16
261 0.17
262 0.2
263 0.23
264 0.21
265 0.21
266 0.2
267 0.19
268 0.17
269 0.16
270 0.13
271 0.09
272 0.06
273 0.05
274 0.06
275 0.05
276 0.05
277 0.04
278 0.05
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.05
285 0.05
286 0.05
287 0.05
288 0.05
289 0.04
290 0.04
291 0.05
292 0.04
293 0.05
294 0.06
295 0.07
296 0.08
297 0.09
298 0.09
299 0.09
300 0.1
301 0.09
302 0.08
303 0.08
304 0.11
305 0.13
306 0.2
307 0.21
308 0.21
309 0.23
310 0.23
311 0.23
312 0.22
313 0.28
314 0.28
315 0.37
316 0.42
317 0.48
318 0.52
319 0.59
320 0.67
321 0.69
322 0.72
323 0.73