Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3XS34

Protein Details
Accession A0A5E3XS34    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
140-163EKRARDVKGREVKRWRRDVPSGRDBasic
NLS Segment(s)
PositionSequence
114-156RERRKEEEKRAREEERRREEEERVLSEKRARDVKGREVKRWRR
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MIDKTPAPSPPPPSESRPPSYHTYNPAPPISRTQSYTKRKPAPPYVDPRPHHIRAANASLDTFLTTRSPMLSAIRDVRDRALSGVDGEEVRIMELERRKAVASGEGQAELGLARERRKEEEKRAREEERRREEEERVLSEKRARDVKGREVKRWRRDVPSGRDVAVEESEWEGGELGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.61
4 0.58
5 0.55
6 0.56
7 0.58
8 0.55
9 0.53
10 0.53
11 0.52
12 0.54
13 0.54
14 0.5
15 0.45
16 0.48
17 0.47
18 0.43
19 0.41
20 0.44
21 0.5
22 0.56
23 0.64
24 0.66
25 0.69
26 0.72
27 0.76
28 0.78
29 0.76
30 0.75
31 0.75
32 0.75
33 0.75
34 0.71
35 0.7
36 0.68
37 0.61
38 0.57
39 0.5
40 0.44
41 0.39
42 0.42
43 0.36
44 0.28
45 0.25
46 0.22
47 0.2
48 0.16
49 0.12
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.1
58 0.1
59 0.12
60 0.16
61 0.18
62 0.19
63 0.19
64 0.19
65 0.18
66 0.17
67 0.15
68 0.12
69 0.1
70 0.09
71 0.09
72 0.08
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.04
79 0.04
80 0.07
81 0.1
82 0.12
83 0.12
84 0.13
85 0.14
86 0.14
87 0.15
88 0.15
89 0.13
90 0.14
91 0.14
92 0.13
93 0.13
94 0.12
95 0.12
96 0.08
97 0.07
98 0.07
99 0.08
100 0.1
101 0.13
102 0.15
103 0.2
104 0.28
105 0.34
106 0.43
107 0.53
108 0.58
109 0.62
110 0.67
111 0.7
112 0.71
113 0.74
114 0.74
115 0.72
116 0.71
117 0.68
118 0.65
119 0.61
120 0.59
121 0.55
122 0.49
123 0.43
124 0.4
125 0.37
126 0.39
127 0.39
128 0.37
129 0.38
130 0.35
131 0.39
132 0.44
133 0.51
134 0.56
135 0.58
136 0.62
137 0.68
138 0.76
139 0.77
140 0.81
141 0.76
142 0.74
143 0.79
144 0.8
145 0.78
146 0.77
147 0.7
148 0.61
149 0.56
150 0.49
151 0.42
152 0.34
153 0.25
154 0.17
155 0.16
156 0.15
157 0.14
158 0.13
159 0.1