Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3WWL4

Protein Details
Accession A0A5E3WWL4    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
57-80AAAGAKKSKKTAKRKHRATDAAHFHydrophilic
192-217PSLALEKKGKGKPKGKNKDNELGRAKBasic
NLS Segment(s)
PositionSequence
61-73AKKSKKTAKRKHR
195-209ALEKKGKGKPKGKNK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MAPATKRRRLSQDSDAASSHSKSDAASSIASLSGAEQDASDAADEFSDEPNTDDEIAAAGAKKSKKTAKRKHRATDAAHFGAALQGLLSTSAPTSLPLALKPEVARRKNEEALEKRARRVLTVEKKEKEDLGRVRDVIGGWGGESERALRKVAQRGVVKLFNAIQQAQMGAREKEEEVKALRGSGKPTLPAPSLALEKKGKGKPKGKNKDNELGRAKDDALGKDDFLDMIRSGGIVSRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.5
4 0.46
5 0.39
6 0.3
7 0.22
8 0.17
9 0.14
10 0.17
11 0.16
12 0.15
13 0.15
14 0.14
15 0.14
16 0.13
17 0.13
18 0.1
19 0.08
20 0.08
21 0.08
22 0.08
23 0.07
24 0.07
25 0.07
26 0.08
27 0.07
28 0.06
29 0.06
30 0.05
31 0.06
32 0.07
33 0.08
34 0.09
35 0.09
36 0.09
37 0.11
38 0.12
39 0.12
40 0.11
41 0.09
42 0.09
43 0.09
44 0.08
45 0.07
46 0.07
47 0.11
48 0.13
49 0.14
50 0.19
51 0.28
52 0.37
53 0.48
54 0.58
55 0.65
56 0.74
57 0.83
58 0.86
59 0.88
60 0.86
61 0.81
62 0.8
63 0.76
64 0.66
65 0.56
66 0.47
67 0.36
68 0.29
69 0.23
70 0.13
71 0.05
72 0.03
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.07
83 0.08
84 0.08
85 0.11
86 0.11
87 0.13
88 0.13
89 0.2
90 0.28
91 0.3
92 0.33
93 0.35
94 0.4
95 0.43
96 0.45
97 0.46
98 0.41
99 0.47
100 0.54
101 0.49
102 0.45
103 0.45
104 0.42
105 0.34
106 0.33
107 0.34
108 0.35
109 0.43
110 0.49
111 0.47
112 0.5
113 0.5
114 0.49
115 0.4
116 0.38
117 0.33
118 0.31
119 0.3
120 0.28
121 0.28
122 0.27
123 0.25
124 0.18
125 0.13
126 0.08
127 0.06
128 0.07
129 0.06
130 0.05
131 0.05
132 0.06
133 0.08
134 0.1
135 0.11
136 0.13
137 0.18
138 0.25
139 0.28
140 0.34
141 0.34
142 0.36
143 0.4
144 0.4
145 0.35
146 0.29
147 0.27
148 0.22
149 0.22
150 0.19
151 0.15
152 0.13
153 0.13
154 0.12
155 0.14
156 0.14
157 0.13
158 0.13
159 0.14
160 0.14
161 0.19
162 0.19
163 0.19
164 0.18
165 0.21
166 0.21
167 0.21
168 0.24
169 0.21
170 0.23
171 0.26
172 0.25
173 0.24
174 0.25
175 0.28
176 0.25
177 0.25
178 0.23
179 0.21
180 0.25
181 0.24
182 0.28
183 0.26
184 0.28
185 0.36
186 0.4
187 0.46
188 0.51
189 0.59
190 0.63
191 0.72
192 0.8
193 0.8
194 0.84
195 0.83
196 0.84
197 0.8
198 0.8
199 0.76
200 0.68
201 0.62
202 0.54
203 0.47
204 0.41
205 0.4
206 0.32
207 0.29
208 0.26
209 0.24
210 0.22
211 0.22
212 0.18
213 0.15
214 0.15
215 0.11
216 0.11
217 0.11
218 0.09
219 0.09