Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3W876

Protein Details
Accession A0A5E3W876    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
361-386DDEGDTRARRARKKQREDDSEKKLQABasic
NLS Segment(s)
PositionSequence
369-375RRARKKQ
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037445  MAGE  
IPR041898  MAGE_WH1  
IPR041899  MAGE_WH2  
IPR002190  MHD_dom  
Pfam View protein in Pfam  
PF01454  MAGE  
PROSITE View protein in PROSITE  
PS50838  MAGE  
Amino Acid Sequences MAPRASGSRSQRNASQAERRSSRRTEVVEEDEEEEVDMDVGEDEPEVDGDLQKRIAALVRLAIFNEQRRIPLKREEISKKVMGTQRGGFKDVFDGAQERLRTIFGMELVELQTRAATQDTALGGGDAGKRKRGADGPSQSQPNGTQASQSQTQDGVGGAKKRGAAASGAKAYILRSTLEGGLIELAAHTDAAVLEAEMADAPDVTDEGEVGARSYGSILAWNTGDHLAALGVMHVVLALILVNGKVVSDGDLRNTLRRLRLREGDVVDFPATAPHRTTPVDSFLSDLVRRQYLDRSRVGGAPGKRGRGAASQAQNDNEGDAYEWRWGPRAFAEVGELGIARFVAELMAERRAAPGVESSDDDEGDTRARRARKKQREDDSEKKLQAMMRGIERAAGGELTDVLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.58
4 0.62
5 0.66
6 0.67
7 0.68
8 0.67
9 0.67
10 0.64
11 0.61
12 0.57
13 0.57
14 0.57
15 0.53
16 0.5
17 0.45
18 0.38
19 0.34
20 0.27
21 0.2
22 0.14
23 0.1
24 0.08
25 0.06
26 0.05
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.09
36 0.1
37 0.12
38 0.13
39 0.13
40 0.13
41 0.13
42 0.15
43 0.14
44 0.14
45 0.17
46 0.18
47 0.19
48 0.19
49 0.22
50 0.24
51 0.26
52 0.3
53 0.26
54 0.29
55 0.34
56 0.38
57 0.38
58 0.43
59 0.47
60 0.47
61 0.56
62 0.59
63 0.6
64 0.61
65 0.6
66 0.52
67 0.52
68 0.51
69 0.45
70 0.42
71 0.42
72 0.44
73 0.43
74 0.44
75 0.37
76 0.32
77 0.31
78 0.28
79 0.23
80 0.16
81 0.15
82 0.14
83 0.19
84 0.18
85 0.16
86 0.15
87 0.15
88 0.14
89 0.13
90 0.13
91 0.09
92 0.1
93 0.09
94 0.1
95 0.11
96 0.11
97 0.1
98 0.09
99 0.08
100 0.07
101 0.08
102 0.08
103 0.06
104 0.06
105 0.09
106 0.09
107 0.1
108 0.1
109 0.09
110 0.08
111 0.1
112 0.13
113 0.14
114 0.15
115 0.18
116 0.19
117 0.19
118 0.23
119 0.26
120 0.28
121 0.33
122 0.39
123 0.42
124 0.46
125 0.48
126 0.44
127 0.4
128 0.36
129 0.3
130 0.26
131 0.2
132 0.16
133 0.16
134 0.2
135 0.23
136 0.23
137 0.2
138 0.17
139 0.17
140 0.16
141 0.15
142 0.13
143 0.11
144 0.13
145 0.13
146 0.14
147 0.14
148 0.14
149 0.14
150 0.12
151 0.13
152 0.13
153 0.17
154 0.17
155 0.16
156 0.16
157 0.16
158 0.15
159 0.14
160 0.12
161 0.08
162 0.07
163 0.09
164 0.09
165 0.09
166 0.08
167 0.07
168 0.06
169 0.06
170 0.05
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.03
192 0.03
193 0.02
194 0.03
195 0.03
196 0.04
197 0.04
198 0.04
199 0.03
200 0.04
201 0.04
202 0.04
203 0.03
204 0.05
205 0.05
206 0.07
207 0.07
208 0.07
209 0.08
210 0.08
211 0.08
212 0.06
213 0.06
214 0.04
215 0.04
216 0.04
217 0.03
218 0.03
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.02
228 0.02
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.05
235 0.07
236 0.08
237 0.1
238 0.15
239 0.15
240 0.18
241 0.2
242 0.21
243 0.26
244 0.31
245 0.35
246 0.36
247 0.42
248 0.43
249 0.47
250 0.47
251 0.43
252 0.38
253 0.35
254 0.29
255 0.23
256 0.19
257 0.17
258 0.15
259 0.13
260 0.14
261 0.13
262 0.16
263 0.17
264 0.19
265 0.18
266 0.21
267 0.22
268 0.21
269 0.21
270 0.2
271 0.22
272 0.2
273 0.2
274 0.17
275 0.17
276 0.18
277 0.18
278 0.25
279 0.29
280 0.34
281 0.35
282 0.36
283 0.36
284 0.37
285 0.38
286 0.36
287 0.31
288 0.36
289 0.37
290 0.36
291 0.35
292 0.34
293 0.34
294 0.32
295 0.35
296 0.33
297 0.36
298 0.38
299 0.4
300 0.4
301 0.4
302 0.35
303 0.3
304 0.22
305 0.16
306 0.12
307 0.1
308 0.1
309 0.12
310 0.14
311 0.13
312 0.18
313 0.18
314 0.19
315 0.19
316 0.22
317 0.19
318 0.18
319 0.2
320 0.16
321 0.16
322 0.14
323 0.13
324 0.09
325 0.08
326 0.07
327 0.05
328 0.04
329 0.04
330 0.04
331 0.04
332 0.07
333 0.09
334 0.12
335 0.12
336 0.12
337 0.13
338 0.14
339 0.14
340 0.12
341 0.14
342 0.15
343 0.16
344 0.18
345 0.19
346 0.19
347 0.19
348 0.19
349 0.16
350 0.14
351 0.16
352 0.16
353 0.17
354 0.22
355 0.3
356 0.38
357 0.48
358 0.59
359 0.66
360 0.75
361 0.83
362 0.88
363 0.91
364 0.92
365 0.91
366 0.89
367 0.87
368 0.77
369 0.68
370 0.61
371 0.52
372 0.48
373 0.45
374 0.41
375 0.36
376 0.38
377 0.36
378 0.34
379 0.32
380 0.27
381 0.22
382 0.17
383 0.12
384 0.1
385 0.1