Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SVH2

Protein Details
Accession Q8SVH2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-67FQATKKYKQSGKRRHTREGFCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR006572  Znf_DBF  
IPR038545  Znf_DBF_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG ecu:ECU05_1330  -  
Pfam View protein in Pfam  
PF07535  zf-DBF  
PROSITE View protein in PROSITE  
PS51265  ZF_DBF4  
Amino Acid Sequences MKNYKVFKKPYILIEDCKNKYQPFYKEYANSEAPKLHLDSPTLCCPFQATKKYKQSGKRRHTREGFCEVCYVRFSNYEEHIKEFEHREFAKDNSNYKKLDTFISTSAFESASPPEEYTPQSPTLKLTPVSSGRNQVGVHCDDNEKYSQTLHFSLVSTEGDLGQDVVLFDHFIAEVFDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.59
4 0.59
5 0.56
6 0.48
7 0.51
8 0.54
9 0.52
10 0.47
11 0.48
12 0.49
13 0.5
14 0.53
15 0.53
16 0.5
17 0.45
18 0.42
19 0.39
20 0.34
21 0.31
22 0.29
23 0.25
24 0.21
25 0.22
26 0.23
27 0.26
28 0.33
29 0.33
30 0.3
31 0.26
32 0.28
33 0.31
34 0.35
35 0.4
36 0.38
37 0.46
38 0.55
39 0.62
40 0.66
41 0.7
42 0.74
43 0.75
44 0.8
45 0.8
46 0.77
47 0.81
48 0.83
49 0.79
50 0.74
51 0.72
52 0.64
53 0.54
54 0.52
55 0.42
56 0.34
57 0.3
58 0.24
59 0.16
60 0.16
61 0.17
62 0.16
63 0.2
64 0.24
65 0.23
66 0.24
67 0.24
68 0.23
69 0.23
70 0.23
71 0.2
72 0.2
73 0.19
74 0.19
75 0.2
76 0.2
77 0.26
78 0.26
79 0.3
80 0.31
81 0.35
82 0.33
83 0.33
84 0.34
85 0.27
86 0.26
87 0.23
88 0.2
89 0.17
90 0.19
91 0.19
92 0.17
93 0.17
94 0.15
95 0.12
96 0.11
97 0.1
98 0.11
99 0.11
100 0.11
101 0.11
102 0.12
103 0.15
104 0.15
105 0.17
106 0.19
107 0.19
108 0.19
109 0.21
110 0.22
111 0.22
112 0.22
113 0.2
114 0.21
115 0.25
116 0.29
117 0.29
118 0.32
119 0.3
120 0.33
121 0.32
122 0.28
123 0.28
124 0.27
125 0.26
126 0.22
127 0.24
128 0.2
129 0.23
130 0.23
131 0.2
132 0.17
133 0.17
134 0.18
135 0.19
136 0.21
137 0.2
138 0.19
139 0.18
140 0.18
141 0.19
142 0.17
143 0.14
144 0.13
145 0.11
146 0.1
147 0.1
148 0.09
149 0.07
150 0.07
151 0.06
152 0.06
153 0.07
154 0.07
155 0.06
156 0.07
157 0.06
158 0.06