Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3X9T2

Protein Details
Accession A0A5E3X9T2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
30-54LSDVEKIRTERRKAKANKNKYTGVGHydrophilic
NLS Segment(s)
PositionSequence
41-44RKAK
Subcellular Location(s) mito 12, nucl 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013809  ENTH  
IPR008942  ENTH_VHS  
Gene Ontology GO:0051179  P:localization  
Pfam View protein in Pfam  
PF01417  ENTH  
PROSITE View protein in PROSITE  
PS50942  ENTH  
Amino Acid Sequences MLRSFHYIDDKGKDQGINVRNRSKELVELLSDVEKIRTERRKAKANKNKYTGVGNDGMAFSSFGGGGSGRYGGFGSDSLGGGGSSSYGGGGYDGNGGGYGSRASGYDREYSSGGGGSSGGFRDSSSNAKFEEYDAGDYEAPRRSGSVNASSSSSSRAAAPARSNTQPPPKAKQAEAPAPAKVVDLLGFDDEEPAVGVNTNKALPTPASVAAPAAPADSFDDEFADFVGAPVSPTTATSPTAIASAPSPAPSGKPNLMDLLNSAPAAGARPPMAGHVSQGSVSSGYGMGMGGGMGGGMGGGMGGGMGGGMGMQQPMYAASPPPMGGMGYGAGGSMMSPSAPPMLSPSSRTTSVSTPPPSSASSTTKTGGGGGFDDLWKTSLGSTGAAKPAQGAQKSMRELGKEKASAGIWGTSVGAASSPKPAGMGAPLGGFGSASGGASGGDDLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.42
4 0.45
5 0.5
6 0.55
7 0.53
8 0.56
9 0.58
10 0.5
11 0.47
12 0.42
13 0.38
14 0.32
15 0.31
16 0.29
17 0.27
18 0.26
19 0.22
20 0.18
21 0.17
22 0.18
23 0.26
24 0.33
25 0.41
26 0.49
27 0.56
28 0.65
29 0.73
30 0.82
31 0.83
32 0.85
33 0.87
34 0.84
35 0.82
36 0.75
37 0.71
38 0.62
39 0.57
40 0.49
41 0.39
42 0.34
43 0.29
44 0.26
45 0.2
46 0.17
47 0.11
48 0.09
49 0.08
50 0.06
51 0.07
52 0.06
53 0.06
54 0.07
55 0.08
56 0.07
57 0.08
58 0.08
59 0.07
60 0.08
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.07
69 0.07
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.04
88 0.05
89 0.05
90 0.07
91 0.1
92 0.13
93 0.17
94 0.18
95 0.19
96 0.2
97 0.2
98 0.18
99 0.17
100 0.14
101 0.09
102 0.09
103 0.07
104 0.08
105 0.07
106 0.07
107 0.06
108 0.07
109 0.09
110 0.11
111 0.17
112 0.17
113 0.19
114 0.19
115 0.2
116 0.2
117 0.19
118 0.22
119 0.17
120 0.17
121 0.17
122 0.18
123 0.17
124 0.17
125 0.19
126 0.17
127 0.16
128 0.15
129 0.15
130 0.14
131 0.17
132 0.2
133 0.24
134 0.23
135 0.23
136 0.25
137 0.24
138 0.24
139 0.23
140 0.2
141 0.14
142 0.12
143 0.14
144 0.15
145 0.17
146 0.2
147 0.21
148 0.25
149 0.26
150 0.28
151 0.31
152 0.39
153 0.42
154 0.43
155 0.45
156 0.49
157 0.51
158 0.49
159 0.5
160 0.47
161 0.48
162 0.49
163 0.44
164 0.36
165 0.33
166 0.32
167 0.26
168 0.19
169 0.13
170 0.08
171 0.07
172 0.07
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.05
186 0.06
187 0.06
188 0.06
189 0.07
190 0.06
191 0.08
192 0.1
193 0.1
194 0.1
195 0.1
196 0.1
197 0.09
198 0.09
199 0.08
200 0.06
201 0.05
202 0.05
203 0.06
204 0.07
205 0.06
206 0.06
207 0.07
208 0.06
209 0.06
210 0.06
211 0.05
212 0.04
213 0.04
214 0.04
215 0.03
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.06
222 0.07
223 0.08
224 0.08
225 0.09
226 0.09
227 0.09
228 0.09
229 0.07
230 0.07
231 0.07
232 0.07
233 0.07
234 0.08
235 0.07
236 0.09
237 0.1
238 0.13
239 0.14
240 0.15
241 0.15
242 0.17
243 0.17
244 0.16
245 0.15
246 0.14
247 0.12
248 0.11
249 0.1
250 0.08
251 0.07
252 0.08
253 0.08
254 0.06
255 0.06
256 0.06
257 0.07
258 0.08
259 0.1
260 0.09
261 0.09
262 0.1
263 0.1
264 0.1
265 0.1
266 0.09
267 0.08
268 0.07
269 0.07
270 0.06
271 0.05
272 0.05
273 0.05
274 0.04
275 0.03
276 0.03
277 0.03
278 0.02
279 0.02
280 0.02
281 0.02
282 0.01
283 0.01
284 0.01
285 0.01
286 0.01
287 0.01
288 0.01
289 0.01
290 0.01
291 0.01
292 0.01
293 0.01
294 0.01
295 0.02
296 0.02
297 0.02
298 0.02
299 0.03
300 0.03
301 0.04
302 0.05
303 0.06
304 0.06
305 0.08
306 0.09
307 0.09
308 0.09
309 0.09
310 0.08
311 0.07
312 0.07
313 0.06
314 0.05
315 0.05
316 0.05
317 0.04
318 0.04
319 0.04
320 0.04
321 0.03
322 0.03
323 0.03
324 0.04
325 0.06
326 0.06
327 0.06
328 0.1
329 0.14
330 0.16
331 0.19
332 0.23
333 0.26
334 0.28
335 0.3
336 0.29
337 0.28
338 0.32
339 0.36
340 0.36
341 0.34
342 0.34
343 0.34
344 0.33
345 0.33
346 0.33
347 0.3
348 0.3
349 0.31
350 0.31
351 0.29
352 0.28
353 0.26
354 0.21
355 0.17
356 0.14
357 0.13
358 0.13
359 0.12
360 0.12
361 0.11
362 0.11
363 0.11
364 0.1
365 0.09
366 0.11
367 0.11
368 0.12
369 0.15
370 0.18
371 0.21
372 0.21
373 0.21
374 0.19
375 0.24
376 0.29
377 0.27
378 0.27
379 0.29
380 0.36
381 0.39
382 0.43
383 0.4
384 0.38
385 0.4
386 0.43
387 0.45
388 0.39
389 0.37
390 0.36
391 0.34
392 0.31
393 0.3
394 0.25
395 0.17
396 0.16
397 0.16
398 0.11
399 0.11
400 0.09
401 0.08
402 0.08
403 0.09
404 0.13
405 0.13
406 0.13
407 0.13
408 0.14
409 0.14
410 0.15
411 0.16
412 0.13
413 0.13
414 0.13
415 0.13
416 0.12
417 0.11
418 0.08
419 0.08
420 0.07
421 0.06
422 0.06
423 0.06
424 0.06
425 0.07
426 0.07