Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3W997

Protein Details
Accession A0A5E3W997    Localization Confidence High Confidence Score 21.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-62GGAPVKRPRGRPKGSKNKKTLEKEABasic
98-121DDGEPAPKKKRGRPPKTKPEDAEEBasic
125-145EAAEPEKKKRGRPPKSASSAVHydrophilic
NLS Segment(s)
PositionSequence
40-57APVKRPRGRPKGSKNKKT
86-140PKKRGRPPKVKTDDGEPAPKKKRGRPPKTKPEDAEEGGDEAAEPEKKKRGRPPKS
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSPSPSSDEVEESAQAVDQLEEGVGESAIPPAPAPVAGGAPVKRPRGRPKGSKNKKTLEKEAAQAAAIASGDPAAIAAAEQATSAPKKRGRPPKVKTDDGEPAPKKKRGRPPKTKPEDAEEGGDEAAEPEKKKRGRPPKSASSAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.08
5 0.06
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.06
17 0.05
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.1
26 0.11
27 0.17
28 0.22
29 0.28
30 0.31
31 0.37
32 0.46
33 0.54
34 0.61
35 0.65
36 0.71
37 0.76
38 0.84
39 0.87
40 0.84
41 0.83
42 0.85
43 0.81
44 0.77
45 0.73
46 0.65
47 0.57
48 0.52
49 0.43
50 0.33
51 0.27
52 0.19
53 0.12
54 0.09
55 0.06
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.04
70 0.06
71 0.07
72 0.13
73 0.17
74 0.24
75 0.33
76 0.44
77 0.52
78 0.62
79 0.66
80 0.72
81 0.75
82 0.74
83 0.67
84 0.62
85 0.6
86 0.53
87 0.58
88 0.49
89 0.5
90 0.52
91 0.56
92 0.56
93 0.57
94 0.64
95 0.66
96 0.74
97 0.77
98 0.81
99 0.87
100 0.9
101 0.9
102 0.83
103 0.79
104 0.75
105 0.66
106 0.58
107 0.48
108 0.39
109 0.3
110 0.27
111 0.19
112 0.12
113 0.13
114 0.13
115 0.13
116 0.16
117 0.25
118 0.3
119 0.38
120 0.48
121 0.56
122 0.63
123 0.73
124 0.78
125 0.81