Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3WSZ0

Protein Details
Accession A0A5E3WSZ0    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-53DSPSSFGQVCRRRRKRFMRRSIRGRKVDYEHydrophilic
NLS Segment(s)
PositionSequence
34-49RRRRKRFMRRSIRGRK
139-164PKKKIKSGPALAPVAAPVHKKRKNKD
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MIATTQRLSRSPNIFAPVPLKPRDSPSSFGQVCRRRRKRFMRRSIRGRKVDYETRKAAFDLSKSGGTPAESAPIPAVAAAATPATAVATESDVESDVTPNSPPALAKKRAVHELKSEEEKDEAVDDVEDEEEPDEEAPPKKKIKSGPALAPVAAPVHKKRKNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.4
4 0.38
5 0.39
6 0.37
7 0.37
8 0.34
9 0.39
10 0.44
11 0.44
12 0.42
13 0.4
14 0.47
15 0.44
16 0.47
17 0.5
18 0.51
19 0.58
20 0.65
21 0.71
22 0.7
23 0.79
24 0.86
25 0.87
26 0.9
27 0.91
28 0.91
29 0.91
30 0.94
31 0.94
32 0.93
33 0.89
34 0.82
35 0.77
36 0.72
37 0.72
38 0.68
39 0.63
40 0.58
41 0.52
42 0.48
43 0.42
44 0.37
45 0.29
46 0.23
47 0.2
48 0.18
49 0.18
50 0.17
51 0.17
52 0.15
53 0.14
54 0.14
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.08
61 0.07
62 0.06
63 0.06
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.06
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.13
91 0.2
92 0.23
93 0.28
94 0.33
95 0.36
96 0.45
97 0.47
98 0.44
99 0.43
100 0.44
101 0.44
102 0.44
103 0.42
104 0.34
105 0.32
106 0.29
107 0.23
108 0.19
109 0.15
110 0.09
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.06
119 0.07
120 0.07
121 0.07
122 0.1
123 0.15
124 0.18
125 0.24
126 0.29
127 0.32
128 0.37
129 0.43
130 0.51
131 0.56
132 0.6
133 0.62
134 0.64
135 0.63
136 0.58
137 0.51
138 0.42
139 0.34
140 0.29
141 0.26
142 0.27
143 0.35
144 0.43