Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VZZ3

Protein Details
Accession H1VZZ3   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-70QAVTGGKTSKRSKKNKIRNDLDKWQRSWHydrophilic
NLS Segment(s)
PositionSequence
52-58KRSKKNK
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
KEGG chig:CH63R_06186  -  
Amino Acid Sequences MSSASNVLVASSNGERSIAGQPSAMLEEYLSSPPTITENLHRQAVTGGKTSKRSKKNKIRNDLDKWQRSWDESGSSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.18
5 0.16
6 0.15
7 0.14
8 0.14
9 0.15
10 0.16
11 0.14
12 0.08
13 0.07
14 0.07
15 0.08
16 0.09
17 0.09
18 0.07
19 0.07
20 0.07
21 0.09
22 0.09
23 0.08
24 0.12
25 0.17
26 0.19
27 0.21
28 0.2
29 0.19
30 0.2
31 0.22
32 0.19
33 0.18
34 0.19
35 0.2
36 0.28
37 0.35
38 0.42
39 0.5
40 0.57
41 0.64
42 0.72
43 0.8
44 0.84
45 0.87
46 0.88
47 0.88
48 0.88
49 0.87
50 0.87
51 0.83
52 0.75
53 0.72
54 0.64
55 0.58
56 0.53
57 0.46
58 0.42