Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VJN3

Protein Details
Accession H1VJN3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPTRPNKKAKKRTEKKPVNPALLLHydrophilic
NLS Segment(s)
PositionSequence
5-17RPNKKAKKRTEKK
Subcellular Location(s) cyto 12.5cyto_mito 12.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Pfam View protein in Pfam  
PF13181  TPR_8  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MAPTRPNKKAKKRTEKKPVNPALLLVEAATKLQEGDLETAVSAAKKALDGTGVGGDYELASVNLLGLITIEMGEVDEARAYFLRAVELDADGALDERIGGGPEKFLWLAQLSEDGGQDSVNWFDKAAQSLRGQIQALAGLPKRTAEQEAQXEERKRKLGGALCAVAEVYMXXLSWEADAEQRCXALITXXG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.93
4 0.93
5 0.91
6 0.86
7 0.76
8 0.67
9 0.59
10 0.48
11 0.39
12 0.27
13 0.2
14 0.13
15 0.12
16 0.11
17 0.07
18 0.06
19 0.06
20 0.07
21 0.07
22 0.09
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.09
29 0.08
30 0.06
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.08
38 0.09
39 0.09
40 0.08
41 0.08
42 0.07
43 0.06
44 0.06
45 0.05
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.02
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.04
79 0.04
80 0.03
81 0.03
82 0.02
83 0.02
84 0.03
85 0.03
86 0.04
87 0.04
88 0.04
89 0.04
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.07
96 0.06
97 0.07
98 0.07
99 0.07
100 0.08
101 0.07
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.09
108 0.09
109 0.08
110 0.1
111 0.11
112 0.14
113 0.15
114 0.17
115 0.15
116 0.2
117 0.21
118 0.23
119 0.22
120 0.19
121 0.18
122 0.15
123 0.15
124 0.15
125 0.15
126 0.13
127 0.13
128 0.13
129 0.14
130 0.15
131 0.17
132 0.16
133 0.2
134 0.27
135 0.36
136 0.43
137 0.48
138 0.52
139 0.5
140 0.54
141 0.5
142 0.42
143 0.41
144 0.41
145 0.4
146 0.42
147 0.42
148 0.35
149 0.34
150 0.33
151 0.25
152 0.18
153 0.12
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.11
162 0.13
163 0.14
164 0.14
165 0.14