Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VA32

Protein Details
Accession H1VA32   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-39SLARRNCYRQKEPVRRLPKIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_mito 12.332, cyto_nucl 11.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Amino Acid Sequences PAVSSAAELNASVESVGQESLARRNCYRQKEPVRRLPKIASVPYVALTGEASVHVTYDHCIIDYLKQVGGRPEWIKLGDIGIRGNGHFMHLEKNSLDIAAVVHSWIKKQQNWWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.06
5 0.07
6 0.08
7 0.16
8 0.22
9 0.25
10 0.26
11 0.35
12 0.43
13 0.5
14 0.55
15 0.58
16 0.63
17 0.71
18 0.78
19 0.79
20 0.81
21 0.75
22 0.73
23 0.66
24 0.62
25 0.57
26 0.51
27 0.42
28 0.35
29 0.32
30 0.28
31 0.25
32 0.18
33 0.12
34 0.09
35 0.07
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.06
45 0.06
46 0.05
47 0.06
48 0.06
49 0.08
50 0.1
51 0.11
52 0.11
53 0.12
54 0.12
55 0.14
56 0.14
57 0.17
58 0.16
59 0.16
60 0.17
61 0.17
62 0.16
63 0.15
64 0.16
65 0.13
66 0.13
67 0.12
68 0.12
69 0.12
70 0.11
71 0.12
72 0.11
73 0.1
74 0.1
75 0.11
76 0.15
77 0.15
78 0.18
79 0.16
80 0.18
81 0.17
82 0.16
83 0.15
84 0.09
85 0.09
86 0.08
87 0.08
88 0.07
89 0.1
90 0.1
91 0.12
92 0.19
93 0.25
94 0.28