Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q8STS7

Protein Details
Accession Q8STS7    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MGRRRVKRRINIPKRQSRLEKRFNCPVCHydrophilic
NLS Segment(s)
PositionSequence
3-18RRRVKRRINIPKRQSR
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGRRRVKRRINIPKRQSRLEKRFNCPVCNHENVVQCTVKKTLMKGFANCSVCEASFACDANKLTTGIDVYSAWVDECCKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.86
4 0.85
5 0.85
6 0.84
7 0.82
8 0.78
9 0.82
10 0.77
11 0.71
12 0.62
13 0.57
14 0.52
15 0.47
16 0.43
17 0.38
18 0.41
19 0.38
20 0.39
21 0.36
22 0.3
23 0.28
24 0.27
25 0.24
26 0.19
27 0.18
28 0.19
29 0.26
30 0.28
31 0.28
32 0.3
33 0.34
34 0.35
35 0.34
36 0.31
37 0.24
38 0.21
39 0.21
40 0.18
41 0.14
42 0.14
43 0.14
44 0.12
45 0.15
46 0.16
47 0.16
48 0.17
49 0.15
50 0.13
51 0.14
52 0.14
53 0.11
54 0.12
55 0.1
56 0.1
57 0.1
58 0.11
59 0.1
60 0.1