Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FSA5

Protein Details
Accession A0A5N6FSA5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-50LGKCQPKWLKHRLSRNRPDKARBasic
NLS Segment(s)
Subcellular Location(s) extr 10, plas 9, E.R. 4, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALSTDTIPYIVFGSLAVIFGVPVFILSLGKCQPKWLKHRLSRNRPDKARHTTTPKGSQASAESAEIQLEEGIFEYHYMSRLSGTNAYQVDMPASPAPAAFVTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.07
5 0.06
6 0.05
7 0.05
8 0.05
9 0.03
10 0.03
11 0.03
12 0.03
13 0.04
14 0.04
15 0.08
16 0.11
17 0.15
18 0.15
19 0.2
20 0.27
21 0.34
22 0.41
23 0.48
24 0.55
25 0.59
26 0.71
27 0.76
28 0.8
29 0.83
30 0.85
31 0.84
32 0.79
33 0.78
34 0.75
35 0.73
36 0.69
37 0.64
38 0.62
39 0.59
40 0.59
41 0.6
42 0.55
43 0.48
44 0.41
45 0.37
46 0.31
47 0.28
48 0.23
49 0.16
50 0.14
51 0.12
52 0.12
53 0.1
54 0.09
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.06
64 0.08
65 0.08
66 0.08
67 0.09
68 0.11
69 0.14
70 0.16
71 0.16
72 0.2
73 0.2
74 0.21
75 0.2
76 0.19
77 0.18
78 0.15
79 0.17
80 0.13
81 0.13
82 0.13
83 0.12
84 0.13