Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FS07

Protein Details
Accession A0A5N6FS07    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTRKTKGTRVERKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-27KTTRKTKGTRVERKKKDPNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRKTKGTRVERKKKDPNAPKRGLSAYMFFANDNREKVREENPGISFGQVGKMLGERWKALSDTDRRPYEEKAAADKKRYEDEKASYHVREPHRIVSLEHANRLQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.9
4 0.91
5 0.92
6 0.91
7 0.9
8 0.9
9 0.9
10 0.9
11 0.86
12 0.78
13 0.72
14 0.65
15 0.57
16 0.49
17 0.4
18 0.32
19 0.28
20 0.25
21 0.21
22 0.2
23 0.2
24 0.21
25 0.21
26 0.19
27 0.18
28 0.2
29 0.22
30 0.26
31 0.29
32 0.29
33 0.31
34 0.31
35 0.31
36 0.3
37 0.27
38 0.22
39 0.15
40 0.14
41 0.09
42 0.08
43 0.06
44 0.06
45 0.07
46 0.09
47 0.1
48 0.09
49 0.1
50 0.12
51 0.12
52 0.12
53 0.18
54 0.22
55 0.28
56 0.35
57 0.36
58 0.38
59 0.4
60 0.41
61 0.4
62 0.39
63 0.34
64 0.36
65 0.43
66 0.43
67 0.46
68 0.47
69 0.45
70 0.48
71 0.49
72 0.45
73 0.42
74 0.44
75 0.44
76 0.45
77 0.47
78 0.4
79 0.42
80 0.45
81 0.44
82 0.46
83 0.45
84 0.46
85 0.47
86 0.47
87 0.43
88 0.44
89 0.49
90 0.45
91 0.46