Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7CM36

Protein Details
Accession A0A5N7CM36    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
182-240KTQPEDSAKKMKKKKVEKSAKRESTKAKKKRSEEGRKDKDKKKERRKKKQETRKARMAQBasic
NLS Segment(s)
PositionSequence
189-238AKKMKKKKVEKSAKRESTKAKKKRSEEGRKDKDKKKERRKKKQETRKARM
Subcellular Location(s) nucl 22.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MDATDLLPLLEQLDDHIDDLDEALCPVLNSAVAATSKKLPVLDKAKFHVLITYALESLIFSYLRLHGVNAKEHPVFRELTRVKQYFDKIKALETEPEQRTLTLDKQAASRFIKHGLAGNDKIDLERKEQQAKEKARAQLKASLLAKKAATAAVPESASKSPANRSESDSDSESDGGEKPTEKTQPEDSAKKMKKKKVEKSAKRESTKAKKKRSEEGRKDKDKKKERRKKKQETRKARMAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.11
5 0.11
6 0.11
7 0.1
8 0.07
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.08
19 0.09
20 0.1
21 0.12
22 0.15
23 0.16
24 0.17
25 0.19
26 0.18
27 0.26
28 0.34
29 0.37
30 0.38
31 0.41
32 0.45
33 0.44
34 0.43
35 0.37
36 0.29
37 0.26
38 0.24
39 0.21
40 0.16
41 0.15
42 0.14
43 0.11
44 0.11
45 0.1
46 0.07
47 0.06
48 0.07
49 0.09
50 0.11
51 0.11
52 0.11
53 0.14
54 0.17
55 0.21
56 0.21
57 0.25
58 0.25
59 0.25
60 0.26
61 0.23
62 0.22
63 0.18
64 0.27
65 0.24
66 0.3
67 0.38
68 0.37
69 0.37
70 0.4
71 0.45
72 0.42
73 0.45
74 0.43
75 0.35
76 0.36
77 0.37
78 0.33
79 0.31
80 0.26
81 0.31
82 0.27
83 0.29
84 0.27
85 0.24
86 0.24
87 0.24
88 0.23
89 0.19
90 0.19
91 0.17
92 0.2
93 0.21
94 0.24
95 0.23
96 0.23
97 0.19
98 0.21
99 0.2
100 0.18
101 0.21
102 0.19
103 0.22
104 0.21
105 0.2
106 0.18
107 0.17
108 0.17
109 0.17
110 0.15
111 0.15
112 0.2
113 0.22
114 0.28
115 0.3
116 0.36
117 0.42
118 0.44
119 0.46
120 0.46
121 0.49
122 0.48
123 0.49
124 0.45
125 0.43
126 0.4
127 0.41
128 0.37
129 0.35
130 0.31
131 0.3
132 0.28
133 0.22
134 0.22
135 0.15
136 0.13
137 0.1
138 0.1
139 0.1
140 0.1
141 0.1
142 0.12
143 0.12
144 0.14
145 0.14
146 0.14
147 0.17
148 0.23
149 0.27
150 0.26
151 0.31
152 0.33
153 0.35
154 0.37
155 0.33
156 0.28
157 0.25
158 0.24
159 0.19
160 0.16
161 0.14
162 0.12
163 0.11
164 0.11
165 0.12
166 0.17
167 0.21
168 0.21
169 0.24
170 0.28
171 0.36
172 0.42
173 0.45
174 0.44
175 0.51
176 0.57
177 0.63
178 0.67
179 0.65
180 0.68
181 0.75
182 0.8
183 0.81
184 0.85
185 0.86
186 0.87
187 0.91
188 0.91
189 0.86
190 0.82
191 0.81
192 0.81
193 0.81
194 0.81
195 0.81
196 0.8
197 0.81
198 0.84
199 0.85
200 0.85
201 0.86
202 0.87
203 0.87
204 0.89
205 0.93
206 0.91
207 0.91
208 0.9
209 0.9
210 0.9
211 0.9
212 0.91
213 0.92
214 0.95
215 0.96
216 0.97
217 0.97
218 0.97
219 0.97
220 0.95