Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6FWL5

Protein Details
Accession A0A5N6FWL5    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-37ECKLRTHKMAWKVRDKRKCRDKSALAKQKLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, E.R. 4, cyto_nucl 2, nucl 1.5, cyto 1.5, extr 1, pero 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCLNGTDECKLRTHKMAWKVRDKRKCRDKSALAKQKLTFRFFFSLVSSPANFRSFVFSFLFLLFLFLVCFIRFSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.57
4 0.6
5 0.67
6 0.73
7 0.77
8 0.81
9 0.8
10 0.81
11 0.83
12 0.84
13 0.8
14 0.8
15 0.79
16 0.8
17 0.84
18 0.84
19 0.77
20 0.73
21 0.67
22 0.66
23 0.61
24 0.53
25 0.43
26 0.37
27 0.35
28 0.31
29 0.29
30 0.23
31 0.21
32 0.19
33 0.2
34 0.17
35 0.15
36 0.18
37 0.18
38 0.17
39 0.15
40 0.2
41 0.18
42 0.21
43 0.22
44 0.19
45 0.2
46 0.19
47 0.2
48 0.13
49 0.14
50 0.11
51 0.09
52 0.08
53 0.08
54 0.09
55 0.08