Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VG60

Protein Details
Accession H1VG60   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-69AFRAAPRRPRGRRSARRRWRERSLRTSRPVFRCRRGRTSTPRRMTRTRIBasic
NLS Segment(s)
PositionSequence
19-64KPAFRAAPRRPRGRRSARRRWRERSLRTSRPVFRCRRGRTSTPRRM
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences SRGRPGAPRDVAGPATTEKPAFRAAPRRPRGRRSARRRWRERSLRTSRPVFRCRRGRTSTPRRMTRTRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.18
5 0.14
6 0.15
7 0.18
8 0.18
9 0.21
10 0.28
11 0.36
12 0.46
13 0.53
14 0.62
15 0.65
16 0.69
17 0.74
18 0.76
19 0.78
20 0.77
21 0.81
22 0.81
23 0.86
24 0.88
25 0.86
26 0.86
27 0.85
28 0.84
29 0.83
30 0.83
31 0.81
32 0.79
33 0.79
34 0.77
35 0.75
36 0.76
37 0.73
38 0.73
39 0.75
40 0.76
41 0.77
42 0.76
43 0.77
44 0.79
45 0.82
46 0.84
47 0.83
48 0.85
49 0.83