Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FE23

Protein Details
Accession A0A5N6FE23   
Localization Confidence High
Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
450-469TATPGKRRGRPRKSLVPGEEBasic
532-574NPDGTVVPQKRRRGRPRKSEMDPNAPPKPKAPRKPASSKPSGTHydrophilic
581-603PLKLWVRAKPNLKHNPNRPRATFHydrophilic
622-654LNQQCRLNRRYQLKIRCKLNPRCKLSQQCKSSLHydrophilic
NLS Segment(s)
PositionSequence
454-482GKRRGRPRKSLVPGEEGKTPKPKKPSKAA
541-598KRRRGRPRKSEMDPNAPPKPKAPRKPASSKPSGTGRPRGRPLKLWVRAKPNLKHNPNR
Subcellular Location(s) cyto_nucl 14.5, nucl 24
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MMGFGGHSFHQQRQTQQNAHPQHQQQLQSPSMGAAAAAAAATQQHHNTAVAGNNSLLRGQQQTDLTAQSPDLRKMTPSSSAPLVGMPAGGGTFASFSGHFPPQGSSELLSRGADSVGQLKDPYLSLQSLQRNMNPMASFRAHPAAAMNAQAAMSPHAHAMGLSSPQQSMDRMQHAQYQQRQTTHTHPAQTSTTASPMLAAAQPQPQHQYQQQQPQYQSAQQQAQYQATQQAQYQQAQQSPYQQAQTQQPQYQAQAQSPYQQQVQQTFQQQQAQQAQVQQQAQQQAQQSYQQHARYQSQQAQRSPYQSQAGQHTFHQAYQQRQYQPQQQAQYTQQAQQHQQRSAQSTPSTMGGSAELPVQEPETEEAKTKRRPKQTKATVSPAISTKQVNGQPPAVYATDAQTQAHAQAQAQAQAQAQAQAQAQAQVQQAQQTQGQPQAPTQDKSASTGNTATPGKRRGRPRKSLVPGEEGKTPKPKKPSKAAAAAAAAAAQGGNVAPAPAATAPATASGLPPGVQGPAPAPGVPGVPGTITNPDGTVVPQKRRRGRPRKSEMDPNAPPKPKAPRKPASSKPSGTGRPRGRPLKLWVRAKPNLKHNPNRPRATFSIHTSIHTSHNRSSHNHRLNQQCRLNRRYQLKIRCKLNPRCKLSQQCKSSLNCRPTTPNSRCTSTTLSTIHMRTSTSTSIIPTPMCINTNTHKPNTHRLNMHRLNTDTSIRTPKRIQWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.65
4 0.7
5 0.69
6 0.7
7 0.71
8 0.65
9 0.65
10 0.64
11 0.62
12 0.58
13 0.58
14 0.55
15 0.47
16 0.43
17 0.35
18 0.29
19 0.23
20 0.16
21 0.09
22 0.07
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.06
29 0.09
30 0.1
31 0.12
32 0.14
33 0.14
34 0.15
35 0.18
36 0.21
37 0.2
38 0.2
39 0.19
40 0.2
41 0.2
42 0.19
43 0.17
44 0.14
45 0.16
46 0.16
47 0.21
48 0.2
49 0.22
50 0.24
51 0.26
52 0.24
53 0.22
54 0.21
55 0.23
56 0.25
57 0.27
58 0.27
59 0.26
60 0.27
61 0.3
62 0.32
63 0.32
64 0.3
65 0.31
66 0.31
67 0.31
68 0.29
69 0.26
70 0.23
71 0.17
72 0.14
73 0.09
74 0.07
75 0.06
76 0.05
77 0.05
78 0.04
79 0.04
80 0.05
81 0.06
82 0.06
83 0.08
84 0.13
85 0.15
86 0.16
87 0.16
88 0.18
89 0.19
90 0.21
91 0.21
92 0.18
93 0.18
94 0.2
95 0.2
96 0.19
97 0.17
98 0.15
99 0.13
100 0.12
101 0.11
102 0.15
103 0.14
104 0.15
105 0.14
106 0.14
107 0.15
108 0.15
109 0.16
110 0.13
111 0.13
112 0.14
113 0.2
114 0.25
115 0.29
116 0.32
117 0.32
118 0.35
119 0.35
120 0.38
121 0.32
122 0.28
123 0.28
124 0.28
125 0.26
126 0.24
127 0.27
128 0.22
129 0.21
130 0.21
131 0.19
132 0.18
133 0.18
134 0.15
135 0.11
136 0.11
137 0.12
138 0.11
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.09
147 0.09
148 0.11
149 0.12
150 0.13
151 0.13
152 0.14
153 0.16
154 0.15
155 0.17
156 0.2
157 0.23
158 0.24
159 0.26
160 0.31
161 0.34
162 0.41
163 0.45
164 0.48
165 0.48
166 0.48
167 0.49
168 0.47
169 0.49
170 0.5
171 0.47
172 0.44
173 0.4
174 0.41
175 0.4
176 0.38
177 0.35
178 0.26
179 0.24
180 0.18
181 0.18
182 0.14
183 0.12
184 0.12
185 0.1
186 0.09
187 0.1
188 0.14
189 0.15
190 0.16
191 0.2
192 0.2
193 0.23
194 0.26
195 0.33
196 0.36
197 0.45
198 0.5
199 0.52
200 0.52
201 0.53
202 0.52
203 0.47
204 0.45
205 0.4
206 0.38
207 0.34
208 0.38
209 0.35
210 0.35
211 0.31
212 0.28
213 0.28
214 0.25
215 0.23
216 0.19
217 0.23
218 0.23
219 0.25
220 0.28
221 0.26
222 0.27
223 0.29
224 0.29
225 0.29
226 0.3
227 0.3
228 0.28
229 0.26
230 0.27
231 0.32
232 0.39
233 0.38
234 0.37
235 0.39
236 0.38
237 0.39
238 0.41
239 0.35
240 0.29
241 0.28
242 0.26
243 0.28
244 0.28
245 0.29
246 0.24
247 0.25
248 0.26
249 0.25
250 0.29
251 0.27
252 0.3
253 0.31
254 0.32
255 0.34
256 0.33
257 0.35
258 0.36
259 0.34
260 0.31
261 0.31
262 0.31
263 0.3
264 0.3
265 0.27
266 0.25
267 0.28
268 0.26
269 0.26
270 0.26
271 0.23
272 0.23
273 0.26
274 0.24
275 0.25
276 0.3
277 0.29
278 0.29
279 0.31
280 0.33
281 0.33
282 0.37
283 0.41
284 0.43
285 0.47
286 0.46
287 0.49
288 0.48
289 0.47
290 0.43
291 0.39
292 0.34
293 0.29
294 0.29
295 0.3
296 0.31
297 0.27
298 0.26
299 0.29
300 0.26
301 0.25
302 0.29
303 0.26
304 0.27
305 0.32
306 0.38
307 0.35
308 0.39
309 0.43
310 0.45
311 0.48
312 0.49
313 0.47
314 0.41
315 0.42
316 0.39
317 0.42
318 0.36
319 0.33
320 0.32
321 0.31
322 0.35
323 0.39
324 0.41
325 0.36
326 0.38
327 0.36
328 0.38
329 0.36
330 0.34
331 0.27
332 0.23
333 0.22
334 0.2
335 0.18
336 0.13
337 0.11
338 0.08
339 0.08
340 0.07
341 0.07
342 0.06
343 0.06
344 0.06
345 0.06
346 0.06
347 0.06
348 0.07
349 0.08
350 0.09
351 0.11
352 0.13
353 0.19
354 0.26
355 0.35
356 0.41
357 0.5
358 0.58
359 0.63
360 0.71
361 0.76
362 0.79
363 0.76
364 0.75
365 0.69
366 0.61
367 0.55
368 0.46
369 0.37
370 0.28
371 0.23
372 0.16
373 0.18
374 0.21
375 0.21
376 0.22
377 0.22
378 0.21
379 0.21
380 0.22
381 0.16
382 0.14
383 0.11
384 0.12
385 0.13
386 0.13
387 0.13
388 0.11
389 0.11
390 0.11
391 0.13
392 0.11
393 0.08
394 0.12
395 0.13
396 0.15
397 0.15
398 0.16
399 0.14
400 0.16
401 0.16
402 0.13
403 0.13
404 0.12
405 0.12
406 0.12
407 0.12
408 0.12
409 0.12
410 0.14
411 0.15
412 0.16
413 0.16
414 0.17
415 0.18
416 0.17
417 0.19
418 0.17
419 0.18
420 0.19
421 0.21
422 0.18
423 0.18
424 0.24
425 0.25
426 0.25
427 0.25
428 0.25
429 0.23
430 0.25
431 0.27
432 0.21
433 0.19
434 0.19
435 0.18
436 0.18
437 0.19
438 0.19
439 0.21
440 0.28
441 0.32
442 0.37
443 0.48
444 0.55
445 0.63
446 0.71
447 0.74
448 0.77
449 0.79
450 0.81
451 0.73
452 0.69
453 0.63
454 0.55
455 0.53
456 0.44
457 0.4
458 0.42
459 0.41
460 0.39
461 0.46
462 0.51
463 0.53
464 0.61
465 0.67
466 0.65
467 0.7
468 0.67
469 0.6
470 0.53
471 0.46
472 0.35
473 0.26
474 0.18
475 0.1
476 0.08
477 0.04
478 0.03
479 0.02
480 0.03
481 0.03
482 0.03
483 0.03
484 0.03
485 0.04
486 0.04
487 0.05
488 0.05
489 0.06
490 0.06
491 0.07
492 0.08
493 0.07
494 0.07
495 0.07
496 0.07
497 0.07
498 0.07
499 0.07
500 0.07
501 0.07
502 0.07
503 0.07
504 0.1
505 0.11
506 0.1
507 0.1
508 0.1
509 0.1
510 0.1
511 0.1
512 0.07
513 0.07
514 0.07
515 0.08
516 0.1
517 0.11
518 0.1
519 0.1
520 0.1
521 0.1
522 0.11
523 0.19
524 0.22
525 0.31
526 0.38
527 0.47
528 0.56
529 0.66
530 0.76
531 0.78
532 0.83
533 0.85
534 0.88
535 0.89
536 0.86
537 0.86
538 0.82
539 0.81
540 0.78
541 0.74
542 0.72
543 0.66
544 0.61
545 0.56
546 0.59
547 0.6
548 0.62
549 0.65
550 0.66
551 0.71
552 0.8
553 0.84
554 0.82
555 0.81
556 0.73
557 0.69
558 0.68
559 0.68
560 0.64
561 0.64
562 0.63
563 0.63
564 0.7
565 0.72
566 0.67
567 0.65
568 0.68
569 0.69
570 0.7
571 0.7
572 0.68
573 0.69
574 0.73
575 0.75
576 0.74
577 0.74
578 0.75
579 0.76
580 0.79
581 0.8
582 0.84
583 0.85
584 0.85
585 0.78
586 0.74
587 0.68
588 0.66
589 0.6
590 0.55
591 0.54
592 0.47
593 0.46
594 0.42
595 0.4
596 0.41
597 0.42
598 0.41
599 0.37
600 0.43
601 0.45
602 0.47
603 0.54
604 0.57
605 0.59
606 0.62
607 0.65
608 0.69
609 0.72
610 0.77
611 0.77
612 0.74
613 0.73
614 0.74
615 0.73
616 0.71
617 0.72
618 0.72
619 0.74
620 0.77
621 0.79
622 0.81
623 0.8
624 0.81
625 0.84
626 0.84
627 0.85
628 0.85
629 0.82
630 0.82
631 0.84
632 0.86
633 0.86
634 0.84
635 0.8
636 0.77
637 0.77
638 0.73
639 0.72
640 0.7
641 0.68
642 0.62
643 0.6
644 0.61
645 0.62
646 0.68
647 0.66
648 0.66
649 0.63
650 0.64
651 0.62
652 0.59
653 0.57
654 0.49
655 0.49
656 0.41
657 0.4
658 0.41
659 0.4
660 0.38
661 0.32
662 0.3
663 0.26
664 0.3
665 0.28
666 0.24
667 0.24
668 0.24
669 0.26
670 0.27
671 0.25
672 0.22
673 0.23
674 0.23
675 0.24
676 0.22
677 0.25
678 0.28
679 0.38
680 0.43
681 0.44
682 0.49
683 0.53
684 0.62
685 0.66
686 0.69
687 0.67
688 0.68
689 0.74
690 0.75
691 0.76
692 0.73
693 0.66
694 0.63
695 0.58
696 0.57
697 0.49
698 0.47
699 0.51
700 0.46
701 0.5
702 0.5