Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V0N6

Protein Details
Accession H1V0N6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-44SITMNTNHHRQPRRKRGPQFLTHCFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 7, plas 4
Family & Domain DBs
Amino Acid Sequences MNARAGLTCSRPIVLARRDSITMNTNHHRQPRRKRGPQFLTHCFLALVVMIGFGHGCEVCRIGSTITRDFSANQVTRSAQQGSLIHRNGNGSASMSRRLLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.32
4 0.34
5 0.35
6 0.35
7 0.36
8 0.33
9 0.3
10 0.31
11 0.34
12 0.36
13 0.39
14 0.47
15 0.53
16 0.57
17 0.65
18 0.7
19 0.76
20 0.81
21 0.84
22 0.87
23 0.87
24 0.87
25 0.83
26 0.77
27 0.7
28 0.61
29 0.52
30 0.41
31 0.32
32 0.22
33 0.14
34 0.08
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.1
51 0.14
52 0.17
53 0.17
54 0.18
55 0.18
56 0.19
57 0.2
58 0.25
59 0.22
60 0.21
61 0.22
62 0.22
63 0.23
64 0.26
65 0.26
66 0.18
67 0.21
68 0.23
69 0.27
70 0.35
71 0.34
72 0.32
73 0.31
74 0.33
75 0.29
76 0.28
77 0.22
78 0.16
79 0.19
80 0.2
81 0.24