Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FM33

Protein Details
Accession A0A5N6FM33    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
142-166GRTSIVRRKSTKKRKADPSPKVLGPHydrophilic
NLS Segment(s)
PositionSequence
148-157RRKSTKKRKA
204-211RSRKRKKR
Subcellular Location(s) nucl 20, mito 4.5, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MSLSKAETDIILNKANVALARSQRLVASWLPPKTLDEQTNKSEEELQREEDEIFTAVPETLGVGAPLPNKAADGSWNRTELGSNDKLRKQLLGKNYNKVMSEKNVAAGRQPGKDKISSGSGSAMSPSQIAGNAVYDDDEEEGRTSIVRRKSTKKRKADPSPKVLGPVEADIDGDGEGTALVKQPPSQLKGRKATSFLDEILAERSRKRKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.16
5 0.18
6 0.19
7 0.24
8 0.24
9 0.25
10 0.24
11 0.24
12 0.25
13 0.21
14 0.24
15 0.27
16 0.27
17 0.28
18 0.29
19 0.3
20 0.32
21 0.37
22 0.36
23 0.36
24 0.4
25 0.43
26 0.46
27 0.44
28 0.4
29 0.4
30 0.36
31 0.36
32 0.34
33 0.32
34 0.3
35 0.3
36 0.3
37 0.22
38 0.21
39 0.14
40 0.11
41 0.08
42 0.08
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.06
52 0.07
53 0.08
54 0.08
55 0.07
56 0.08
57 0.08
58 0.08
59 0.12
60 0.16
61 0.21
62 0.23
63 0.24
64 0.24
65 0.24
66 0.24
67 0.2
68 0.21
69 0.22
70 0.24
71 0.28
72 0.3
73 0.31
74 0.31
75 0.33
76 0.29
77 0.28
78 0.34
79 0.39
80 0.41
81 0.45
82 0.47
83 0.46
84 0.44
85 0.4
86 0.33
87 0.26
88 0.26
89 0.2
90 0.21
91 0.2
92 0.19
93 0.18
94 0.21
95 0.2
96 0.2
97 0.22
98 0.21
99 0.21
100 0.22
101 0.22
102 0.19
103 0.21
104 0.18
105 0.17
106 0.16
107 0.15
108 0.14
109 0.13
110 0.12
111 0.08
112 0.07
113 0.07
114 0.06
115 0.05
116 0.06
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.08
132 0.13
133 0.2
134 0.26
135 0.31
136 0.41
137 0.52
138 0.63
139 0.72
140 0.77
141 0.8
142 0.84
143 0.9
144 0.91
145 0.89
146 0.87
147 0.83
148 0.74
149 0.68
150 0.58
151 0.48
152 0.39
153 0.31
154 0.24
155 0.17
156 0.16
157 0.11
158 0.11
159 0.09
160 0.07
161 0.06
162 0.04
163 0.04
164 0.04
165 0.05
166 0.06
167 0.07
168 0.08
169 0.09
170 0.16
171 0.22
172 0.26
173 0.35
174 0.41
175 0.5
176 0.58
177 0.63
178 0.61
179 0.58
180 0.57
181 0.54
182 0.49
183 0.4
184 0.34
185 0.28
186 0.25
187 0.26
188 0.27
189 0.23
190 0.25
191 0.34