Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VC69

Protein Details
Accession H1VC69    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
100-124KEDENGKKKAGKKKGKKIKLSFDPEBasic
NLS Segment(s)
PositionSequence
59-73KLAGIGASKKRKAGK
104-118NGKKKAGKKKGKKIK
Subcellular Location(s) cyto_nucl 15.5, cyto 14, nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences RSESEEAEDAPLVVDDEGNVVDVRVDKDGGVDESALKKDGEVGDETGAGREESRREAEKLAGIGASKKRKAGKVVGGGGGDGGYGDAAEDASNNVKKDSKEDENGKKKAGKKKGKKIKLSFDPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.06
4 0.06
5 0.07
6 0.06
7 0.05
8 0.06
9 0.08
10 0.09
11 0.1
12 0.1
13 0.09
14 0.1
15 0.11
16 0.12
17 0.1
18 0.09
19 0.1
20 0.12
21 0.13
22 0.13
23 0.12
24 0.1
25 0.13
26 0.13
27 0.13
28 0.13
29 0.13
30 0.12
31 0.13
32 0.13
33 0.1
34 0.1
35 0.08
36 0.07
37 0.07
38 0.08
39 0.1
40 0.13
41 0.15
42 0.16
43 0.17
44 0.17
45 0.17
46 0.16
47 0.14
48 0.11
49 0.09
50 0.11
51 0.16
52 0.2
53 0.19
54 0.23
55 0.26
56 0.29
57 0.33
58 0.35
59 0.37
60 0.39
61 0.4
62 0.39
63 0.35
64 0.32
65 0.28
66 0.22
67 0.15
68 0.07
69 0.05
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.03
76 0.03
77 0.04
78 0.09
79 0.12
80 0.12
81 0.14
82 0.17
83 0.18
84 0.23
85 0.29
86 0.32
87 0.38
88 0.47
89 0.56
90 0.62
91 0.65
92 0.65
93 0.64
94 0.65
95 0.66
96 0.68
97 0.68
98 0.7
99 0.78
100 0.85
101 0.89
102 0.92
103 0.91
104 0.91