Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6G1A7

Protein Details
Accession A0A5N6G1A7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-121YEPISPKKENNLNRKKKRKEKKFFSHRREVNRATBasic
NLS Segment(s)
PositionSequence
95-114KENNLNRKKKRKEKKFFSHR
Subcellular Location(s) nucl 15, cyto_nucl 10.833, mito_nucl 10.333, cyto 5.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSESFGTLIGGWKTERGSKARVTNRSMRDISRLYATLSMYLFVVVLEENSEKRSVLTWIQLFSIVSSLGANLYGVSGVWVDSLCTFQYEPISPKKENNLNRKKKRKEKKFFSHRREVNRATDMRPDLNLLKSLLNRHPPQNPSSSNPPLTKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.25
4 0.3
5 0.35
6 0.44
7 0.51
8 0.56
9 0.57
10 0.62
11 0.63
12 0.66
13 0.62
14 0.54
15 0.51
16 0.46
17 0.41
18 0.36
19 0.32
20 0.25
21 0.25
22 0.24
23 0.2
24 0.18
25 0.16
26 0.12
27 0.11
28 0.1
29 0.07
30 0.07
31 0.04
32 0.04
33 0.05
34 0.06
35 0.06
36 0.08
37 0.09
38 0.08
39 0.09
40 0.1
41 0.1
42 0.11
43 0.16
44 0.16
45 0.16
46 0.17
47 0.17
48 0.16
49 0.14
50 0.13
51 0.07
52 0.06
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.05
70 0.04
71 0.05
72 0.05
73 0.06
74 0.08
75 0.1
76 0.13
77 0.19
78 0.24
79 0.24
80 0.26
81 0.33
82 0.39
83 0.45
84 0.54
85 0.58
86 0.65
87 0.74
88 0.83
89 0.86
90 0.89
91 0.92
92 0.92
93 0.92
94 0.92
95 0.93
96 0.94
97 0.94
98 0.92
99 0.92
100 0.88
101 0.86
102 0.84
103 0.77
104 0.72
105 0.69
106 0.63
107 0.54
108 0.55
109 0.48
110 0.41
111 0.37
112 0.34
113 0.29
114 0.28
115 0.28
116 0.22
117 0.23
118 0.24
119 0.29
120 0.32
121 0.38
122 0.4
123 0.44
124 0.5
125 0.51
126 0.52
127 0.55
128 0.53
129 0.51
130 0.56
131 0.57
132 0.57