Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SR18

Protein Details
Accession Q8SR18   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
69-91NLECTKCKFSHQKPLKRAKHVIFHydrophilic
NLS Segment(s)
PositionSequence
26-65AKKSKDNPRAQGNRRYARKQRGYGGQTKPILRRKAKVTKK
84-98KRAKHVIFGGERKRK
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ecu:ECU10_1300  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
Amino Acid Sequences MVNIPKTRNTFCKKCKGYSAHKVSQAKKSKDNPRAQGNRRYARKQRGYGGQTKPILRRKAKVTKKLVLNLECTKCKFSHQKPLKRAKHVIFGGERKRKGEALVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.72
4 0.73
5 0.74
6 0.75
7 0.71
8 0.74
9 0.76
10 0.71
11 0.73
12 0.73
13 0.67
14 0.66
15 0.69
16 0.71
17 0.73
18 0.77
19 0.74
20 0.74
21 0.79
22 0.77
23 0.77
24 0.76
25 0.75
26 0.73
27 0.74
28 0.72
29 0.72
30 0.74
31 0.69
32 0.65
33 0.65
34 0.63
35 0.63
36 0.58
37 0.55
38 0.5
39 0.49
40 0.5
41 0.48
42 0.51
43 0.45
44 0.46
45 0.48
46 0.55
47 0.61
48 0.64
49 0.64
50 0.63
51 0.66
52 0.68
53 0.66
54 0.58
55 0.56
56 0.53
57 0.51
58 0.48
59 0.44
60 0.4
61 0.34
62 0.39
63 0.43
64 0.41
65 0.48
66 0.55
67 0.63
68 0.7
69 0.81
70 0.83
71 0.81
72 0.84
73 0.77
74 0.77
75 0.69
76 0.66
77 0.63
78 0.63
79 0.65
80 0.66
81 0.64
82 0.56
83 0.57
84 0.52