Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VE92

Protein Details
Accession H1VE92   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
61-90KEQNSPPIDRPTRKRRRRRRRRAQRQRLTDBasic
NLS Segment(s)
PositionSequence
70-86RPTRKRRRRRRRRAQRQ
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 6, pero 2
Family & Domain DBs
Amino Acid Sequences ENFFIPTTTVVGIAAFTSRDLHRWKKHRFWEPGALREARKNIDVPQPPTNTLADSINHITKEQNSPPIDRPTRKRRRRRRRRAQRQRLTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.09
5 0.09
6 0.14
7 0.2
8 0.28
9 0.37
10 0.46
11 0.55
12 0.61
13 0.7
14 0.75
15 0.77
16 0.74
17 0.76
18 0.71
19 0.68
20 0.63
21 0.56
22 0.47
23 0.43
24 0.4
25 0.3
26 0.27
27 0.22
28 0.21
29 0.27
30 0.3
31 0.31
32 0.35
33 0.35
34 0.35
35 0.35
36 0.32
37 0.24
38 0.21
39 0.18
40 0.12
41 0.14
42 0.15
43 0.16
44 0.16
45 0.16
46 0.16
47 0.17
48 0.23
49 0.22
50 0.27
51 0.27
52 0.31
53 0.36
54 0.45
55 0.5
56 0.51
57 0.58
58 0.62
59 0.71
60 0.78
61 0.83
62 0.85
63 0.89
64 0.93
65 0.95
66 0.96
67 0.96
68 0.97
69 0.98
70 0.98