Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6G9P2

Protein Details
Accession A0A5N6G9P2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-38IKEKWRKAIQLEKKIKARRELRQQRGYDHydrophilic
NLS Segment(s)
PositionSequence
14-32KWRKAIQLEKKIKARRELR
Subcellular Location(s) mito 11.5, cyto_mito 11, cyto 9.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MTIQIKLSVWIKEKWRKAIQLEKKIKARRELRQQRGYDANDHRQKDSERTRGRSSLKSKESYRERVRKHEEFLTEKNMSKGYKFGEGYPAPTLKEPKEFIRWLIEFTEGRLAFNGRPTMLTIKVRAQEFILGFFLKTGNGIPSHDATDLYYWIKNELVEEEVLSAATDDPFFMSGRYRVQFHFITLQFLCTGARVSSFTPASVDKVGQGLHYKVRLMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.64
4 0.68
5 0.73
6 0.74
7 0.76
8 0.79
9 0.78
10 0.8
11 0.81
12 0.79
13 0.78
14 0.76
15 0.74
16 0.76
17 0.79
18 0.8
19 0.82
20 0.78
21 0.74
22 0.73
23 0.66
24 0.64
25 0.6
26 0.6
27 0.59
28 0.59
29 0.54
30 0.51
31 0.51
32 0.52
33 0.53
34 0.53
35 0.54
36 0.57
37 0.61
38 0.64
39 0.66
40 0.65
41 0.64
42 0.63
43 0.61
44 0.62
45 0.59
46 0.61
47 0.64
48 0.65
49 0.69
50 0.68
51 0.66
52 0.69
53 0.75
54 0.7
55 0.66
56 0.62
57 0.57
58 0.54
59 0.52
60 0.49
61 0.43
62 0.4
63 0.37
64 0.34
65 0.29
66 0.24
67 0.23
68 0.18
69 0.21
70 0.21
71 0.21
72 0.25
73 0.25
74 0.27
75 0.27
76 0.26
77 0.2
78 0.21
79 0.24
80 0.17
81 0.21
82 0.21
83 0.21
84 0.26
85 0.26
86 0.25
87 0.29
88 0.28
89 0.25
90 0.24
91 0.23
92 0.17
93 0.17
94 0.23
95 0.16
96 0.16
97 0.15
98 0.16
99 0.13
100 0.16
101 0.16
102 0.09
103 0.1
104 0.11
105 0.13
106 0.15
107 0.16
108 0.15
109 0.18
110 0.22
111 0.22
112 0.21
113 0.19
114 0.19
115 0.18
116 0.18
117 0.15
118 0.11
119 0.11
120 0.11
121 0.1
122 0.07
123 0.07
124 0.06
125 0.07
126 0.07
127 0.08
128 0.1
129 0.11
130 0.13
131 0.13
132 0.12
133 0.11
134 0.12
135 0.13
136 0.12
137 0.12
138 0.11
139 0.12
140 0.12
141 0.11
142 0.11
143 0.11
144 0.11
145 0.1
146 0.09
147 0.09
148 0.08
149 0.08
150 0.07
151 0.06
152 0.05
153 0.06
154 0.05
155 0.05
156 0.05
157 0.06
158 0.07
159 0.07
160 0.09
161 0.11
162 0.17
163 0.19
164 0.21
165 0.21
166 0.26
167 0.27
168 0.27
169 0.33
170 0.28
171 0.31
172 0.29
173 0.29
174 0.24
175 0.24
176 0.21
177 0.13
178 0.14
179 0.09
180 0.11
181 0.11
182 0.12
183 0.18
184 0.19
185 0.18
186 0.19
187 0.2
188 0.22
189 0.22
190 0.22
191 0.16
192 0.18
193 0.18
194 0.18
195 0.21
196 0.21
197 0.25
198 0.27