Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6G9P2

Protein Details
Accession A0A5N6G9P2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-38IKEKWRKAIQLEKKIKARRELRQQRGYDHydrophilic
NLS Segment(s)
PositionSequence
14-32KWRKAIQLEKKIKARRELR
Subcellular Location(s) cyto 9.5, cyto_mito 11, mito 11.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MTIQIKLSVWIKEKWRKAIQLEKKIKARRELRQQRGYDANDHRQKDSERTRGRSSLKSKESYRERVRKHEEFLTEKNMSKGYKFGEGYPAPTLKEPKEFIRWLIEFTEGRLAFNGRPTMLTIKVRAQEFILGFFLKTGNGIPSHDATDLYYWIKNELVEEEVLSAATDDPFFMSGRYRVQFHFITLQFLCTGARVSSFTPASVDKVGQGLHYKVRLMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.64
4 0.68
5 0.73
6 0.74
7 0.76
8 0.79
9 0.78
10 0.8
11 0.81
12 0.79
13 0.78
14 0.76
15 0.74
16 0.76
17 0.79
18 0.8
19 0.82
20 0.78
21 0.74
22 0.73
23 0.66
24 0.64
25 0.6
26 0.6
27 0.59
28 0.59
29 0.54
30 0.51
31 0.51
32 0.52
33 0.53
34 0.53
35 0.54
36 0.57
37 0.61
38 0.64
39 0.66
40 0.65
41 0.64
42 0.63
43 0.61
44 0.62
45 0.59
46 0.61
47 0.64
48 0.65
49 0.69
50 0.68
51 0.66
52 0.69
53 0.75
54 0.7
55 0.66
56 0.62
57 0.57
58 0.54
59 0.52
60 0.49
61 0.43
62 0.4
63 0.37
64 0.34
65 0.29
66 0.24
67 0.23
68 0.18
69 0.21
70 0.21
71 0.21
72 0.25
73 0.25
74 0.27
75 0.27
76 0.26
77 0.2
78 0.21
79 0.24
80 0.17
81 0.21
82 0.21
83 0.21
84 0.26
85 0.26
86 0.25
87 0.29
88 0.28
89 0.25
90 0.24
91 0.23
92 0.17
93 0.17
94 0.23
95 0.16
96 0.16
97 0.15
98 0.16
99 0.13
100 0.16
101 0.16
102 0.09
103 0.1
104 0.11
105 0.13
106 0.15
107 0.16
108 0.15
109 0.18
110 0.22
111 0.22
112 0.21
113 0.19
114 0.19
115 0.18
116 0.18
117 0.15
118 0.11
119 0.11
120 0.11
121 0.1
122 0.07
123 0.07
124 0.06
125 0.07
126 0.07
127 0.08
128 0.1
129 0.11
130 0.13
131 0.13
132 0.12
133 0.11
134 0.12
135 0.13
136 0.12
137 0.12
138 0.11
139 0.12
140 0.12
141 0.11
142 0.11
143 0.11
144 0.11
145 0.1
146 0.09
147 0.09
148 0.08
149 0.08
150 0.07
151 0.06
152 0.05
153 0.06
154 0.05
155 0.05
156 0.05
157 0.06
158 0.07
159 0.07
160 0.09
161 0.11
162 0.17
163 0.19
164 0.21
165 0.21
166 0.26
167 0.27
168 0.27
169 0.33
170 0.28
171 0.31
172 0.29
173 0.29
174 0.24
175 0.24
176 0.21
177 0.13
178 0.14
179 0.09
180 0.11
181 0.11
182 0.12
183 0.18
184 0.19
185 0.18
186 0.19
187 0.2
188 0.22
189 0.22
190 0.22
191 0.16
192 0.18
193 0.18
194 0.18
195 0.21
196 0.21
197 0.25
198 0.27