Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FU84

Protein Details
Accession A0A5N6FU84   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
62-90GTTSTPRSSRPKKSPNKSKKSHCKAELFKHydrophilic
NLS Segment(s)
PositionSequence
70-81SRPKKSPNKSKK
Subcellular Location(s) cyto_nucl 8.333, mito 11.5, mito_nucl 13.333, nucl 14
Family & Domain DBs
Amino Acid Sequences MSTVRRSKAMPTDGPTVKFLYTIIKQLDLKSIDWSLVANQLEISNGHAARMRYSRFKQQMEGTTSTPRSSRPKKSPNKSKKSHCKAELFKETDPSDPQPGMKQERRASLDEIASYIKADPHAQRFHTLADIPGVAYHMLPDSPDQSFTSPYSQMAVSPSDLTMYTPTPSFLDPSIGFKHQTNPGYLWPSTKMEPEEDGRLSDIVKVEEQQEQEVDSSRSEVEFCGLKVVMEPKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.44
4 0.36
5 0.31
6 0.26
7 0.24
8 0.21
9 0.25
10 0.25
11 0.28
12 0.29
13 0.3
14 0.36
15 0.32
16 0.31
17 0.28
18 0.27
19 0.22
20 0.21
21 0.2
22 0.14
23 0.18
24 0.17
25 0.13
26 0.13
27 0.13
28 0.14
29 0.13
30 0.15
31 0.13
32 0.13
33 0.14
34 0.17
35 0.17
36 0.21
37 0.26
38 0.27
39 0.31
40 0.35
41 0.44
42 0.49
43 0.51
44 0.52
45 0.53
46 0.57
47 0.55
48 0.54
49 0.46
50 0.45
51 0.44
52 0.4
53 0.34
54 0.3
55 0.34
56 0.39
57 0.47
58 0.5
59 0.6
60 0.7
61 0.8
62 0.87
63 0.88
64 0.9
65 0.89
66 0.9
67 0.9
68 0.89
69 0.88
70 0.83
71 0.82
72 0.78
73 0.78
74 0.76
75 0.69
76 0.6
77 0.56
78 0.5
79 0.43
80 0.39
81 0.32
82 0.25
83 0.22
84 0.21
85 0.19
86 0.23
87 0.28
88 0.29
89 0.34
90 0.35
91 0.41
92 0.44
93 0.43
94 0.4
95 0.35
96 0.32
97 0.25
98 0.23
99 0.17
100 0.13
101 0.11
102 0.09
103 0.07
104 0.07
105 0.09
106 0.11
107 0.16
108 0.19
109 0.19
110 0.21
111 0.21
112 0.21
113 0.2
114 0.18
115 0.13
116 0.11
117 0.1
118 0.08
119 0.07
120 0.07
121 0.06
122 0.05
123 0.05
124 0.04
125 0.04
126 0.05
127 0.05
128 0.07
129 0.07
130 0.09
131 0.09
132 0.1
133 0.12
134 0.13
135 0.15
136 0.14
137 0.14
138 0.14
139 0.13
140 0.13
141 0.13
142 0.13
143 0.11
144 0.11
145 0.1
146 0.1
147 0.1
148 0.1
149 0.1
150 0.1
151 0.1
152 0.09
153 0.1
154 0.11
155 0.11
156 0.12
157 0.11
158 0.14
159 0.14
160 0.18
161 0.21
162 0.22
163 0.23
164 0.22
165 0.27
166 0.3
167 0.31
168 0.29
169 0.28
170 0.31
171 0.35
172 0.34
173 0.31
174 0.28
175 0.29
176 0.28
177 0.29
178 0.26
179 0.24
180 0.27
181 0.28
182 0.29
183 0.27
184 0.26
185 0.24
186 0.22
187 0.2
188 0.19
189 0.18
190 0.15
191 0.15
192 0.15
193 0.16
194 0.2
195 0.21
196 0.2
197 0.18
198 0.18
199 0.18
200 0.2
201 0.19
202 0.15
203 0.16
204 0.15
205 0.15
206 0.14
207 0.13
208 0.13
209 0.14
210 0.14
211 0.16
212 0.16
213 0.15
214 0.18