Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6G6J5

Protein Details
Accession A0A5N6G6J5    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28GWTLCCVTRKRRCLRSGQRCRIVPRCRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 5, nucl 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGWTLCCVTRKRRCLRSGQRCRIVPRCRQRQLLLPTTFYPLHLDSHLSSDVTGLLLSGFLPYTLTLCTLLIISILLITDGPYLAAVMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.83
3 0.84
4 0.86
5 0.86
6 0.85
7 0.81
8 0.82
9 0.81
10 0.77
11 0.76
12 0.75
13 0.75
14 0.73
15 0.73
16 0.68
17 0.68
18 0.67
19 0.66
20 0.57
21 0.49
22 0.44
23 0.42
24 0.4
25 0.31
26 0.26
27 0.17
28 0.17
29 0.14
30 0.15
31 0.11
32 0.14
33 0.14
34 0.11
35 0.1
36 0.09
37 0.09
38 0.07
39 0.06
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05