Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VYS1

Protein Details
Accession H1VYS1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-72QYRQRHIKPSEGKRTSKRKRTAPGAASHydrophilic
NLS Segment(s)
PositionSequence
52-67IKPSEGKRTSKRKRTA
Subcellular Location(s) mito 15, mito_nucl 12.166, cyto_mito 9.666, nucl 8, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
KEGG chig:CH63R_02817  -  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MATQLRKKLVYSVDSPFSATHWPDITPEDQDAILELLLSLLSPLGQYRQRHIKPSEGKRTSKRKRTAPGAASTEPVKSERPPAPELASFIDVGLVAITRNLEKLAAGQQGFEGTSKHDNAAANSPSPYSIIFVARSGQPSAFNCQLPQMVAVASKSSPSEPPTRLVGYSRPCAEKLSACLGIPRASAVGIRVGAPMSKALVDYVQQHVSPVRVAWLDEAEKAVYRPTQLKIDEKMVPAKKSGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.33
4 0.29
5 0.29
6 0.26
7 0.23
8 0.2
9 0.2
10 0.2
11 0.24
12 0.24
13 0.21
14 0.21
15 0.18
16 0.17
17 0.16
18 0.15
19 0.13
20 0.1
21 0.08
22 0.06
23 0.05
24 0.05
25 0.05
26 0.04
27 0.03
28 0.03
29 0.03
30 0.04
31 0.09
32 0.15
33 0.17
34 0.24
35 0.35
36 0.38
37 0.45
38 0.48
39 0.53
40 0.57
41 0.66
42 0.71
43 0.67
44 0.71
45 0.73
46 0.82
47 0.82
48 0.83
49 0.81
50 0.78
51 0.8
52 0.82
53 0.82
54 0.76
55 0.73
56 0.7
57 0.62
58 0.55
59 0.47
60 0.39
61 0.3
62 0.26
63 0.2
64 0.14
65 0.2
66 0.23
67 0.27
68 0.28
69 0.29
70 0.31
71 0.3
72 0.3
73 0.26
74 0.23
75 0.18
76 0.16
77 0.14
78 0.1
79 0.09
80 0.07
81 0.04
82 0.03
83 0.03
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.06
91 0.09
92 0.12
93 0.12
94 0.12
95 0.12
96 0.12
97 0.13
98 0.12
99 0.08
100 0.07
101 0.1
102 0.1
103 0.1
104 0.12
105 0.13
106 0.14
107 0.19
108 0.18
109 0.15
110 0.15
111 0.15
112 0.13
113 0.13
114 0.11
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.09
121 0.1
122 0.12
123 0.11
124 0.11
125 0.12
126 0.13
127 0.18
128 0.19
129 0.19
130 0.17
131 0.18
132 0.18
133 0.16
134 0.15
135 0.1
136 0.08
137 0.08
138 0.08
139 0.07
140 0.07
141 0.07
142 0.08
143 0.08
144 0.1
145 0.13
146 0.19
147 0.19
148 0.22
149 0.25
150 0.25
151 0.25
152 0.25
153 0.28
154 0.27
155 0.3
156 0.31
157 0.3
158 0.29
159 0.3
160 0.3
161 0.27
162 0.26
163 0.27
164 0.25
165 0.22
166 0.24
167 0.23
168 0.23
169 0.2
170 0.17
171 0.11
172 0.1
173 0.11
174 0.09
175 0.1
176 0.09
177 0.1
178 0.1
179 0.1
180 0.1
181 0.1
182 0.1
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.1
189 0.12
190 0.16
191 0.18
192 0.17
193 0.18
194 0.19
195 0.19
196 0.18
197 0.15
198 0.14
199 0.13
200 0.14
201 0.14
202 0.17
203 0.17
204 0.17
205 0.19
206 0.16
207 0.16
208 0.16
209 0.18
210 0.15
211 0.17
212 0.21
213 0.23
214 0.29
215 0.32
216 0.38
217 0.4
218 0.44
219 0.46
220 0.45
221 0.51
222 0.5
223 0.48
224 0.47