Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VPQ8

Protein Details
Accession H1VPQ8   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
50-80PAAGGAAKKKKKNKKKKKKKSPTAQSDPPRVBasic
NLS Segment(s)
PositionSequence
54-70GAAKKKKKNKKKKKKKS
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
Gene Ontology GO:0004177  F:aminopeptidase activity  
Amino Acid Sequences MAAQVPTEALKKLNVGEPATNGKAAKPEEGNGVDHDSDDSDEEGEEVTAPAAGGAAKKKKKNKKKKKKKSPTAQSDPPRVLMSSLFPNKNYPKGQEEEYRDENLWRTTNEEKRHLDNLNNDFLTDYREAAEIHRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.25
4 0.27
5 0.32
6 0.32
7 0.32
8 0.27
9 0.24
10 0.27
11 0.26
12 0.27
13 0.22
14 0.22
15 0.25
16 0.27
17 0.28
18 0.24
19 0.26
20 0.21
21 0.2
22 0.19
23 0.13
24 0.12
25 0.11
26 0.1
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.04
40 0.05
41 0.09
42 0.17
43 0.22
44 0.29
45 0.38
46 0.49
47 0.6
48 0.7
49 0.77
50 0.81
51 0.88
52 0.93
53 0.96
54 0.97
55 0.97
56 0.96
57 0.96
58 0.94
59 0.91
60 0.89
61 0.84
62 0.79
63 0.69
64 0.59
65 0.49
66 0.38
67 0.3
68 0.21
69 0.17
70 0.19
71 0.24
72 0.23
73 0.23
74 0.29
75 0.31
76 0.37
77 0.37
78 0.33
79 0.32
80 0.34
81 0.38
82 0.4
83 0.44
84 0.44
85 0.45
86 0.44
87 0.4
88 0.38
89 0.36
90 0.32
91 0.28
92 0.21
93 0.23
94 0.29
95 0.36
96 0.4
97 0.46
98 0.46
99 0.49
100 0.55
101 0.53
102 0.5
103 0.51
104 0.5
105 0.5
106 0.46
107 0.4
108 0.35
109 0.32
110 0.32
111 0.24
112 0.2
113 0.13
114 0.14
115 0.15