Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6GAY5

Protein Details
Accession A0A5N6GAY5   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPPDRQPAPKRRQLPFKPPSRQQSATHydrophilic
NLS Segment(s)
PositionSequence
11-12RR
31-57TASKPNAKGKTKAKAPAKASSSKTRRS
Subcellular Location(s) cyto 3.5, cyto_nucl 12.5, nucl 20.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018552  CENP-X  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
GO:0051382  P:kinetochore assembly  
Pfam View protein in Pfam  
PF09415  CENP-X  
Amino Acid Sequences MPPDRQPAPKRRQLPFKPPSRQQSATAGPSTASKPNAKGKTKAKAPAKASSSKTRRSEPPAPASASTSASNSDSGSGSGSESDSRSRSPSEEPEYILAEITNARAHEPDVLSSDPAIPPKLLTKLVHHHFKNEKTKLAKDANGVVAKYVDVFVREALARAAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.83
4 0.83
5 0.83
6 0.84
7 0.81
8 0.75
9 0.68
10 0.67
11 0.63
12 0.58
13 0.5
14 0.42
15 0.33
16 0.32
17 0.31
18 0.27
19 0.25
20 0.23
21 0.26
22 0.36
23 0.44
24 0.46
25 0.52
26 0.55
27 0.6
28 0.64
29 0.68
30 0.66
31 0.66
32 0.65
33 0.65
34 0.62
35 0.6
36 0.59
37 0.6
38 0.58
39 0.59
40 0.59
41 0.56
42 0.57
43 0.58
44 0.61
45 0.58
46 0.59
47 0.54
48 0.52
49 0.48
50 0.44
51 0.37
52 0.31
53 0.25
54 0.18
55 0.15
56 0.13
57 0.13
58 0.11
59 0.1
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.06
66 0.07
67 0.06
68 0.07
69 0.08
70 0.09
71 0.09
72 0.11
73 0.11
74 0.13
75 0.15
76 0.2
77 0.24
78 0.24
79 0.25
80 0.25
81 0.25
82 0.23
83 0.21
84 0.15
85 0.09
86 0.08
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.08
93 0.11
94 0.11
95 0.11
96 0.13
97 0.13
98 0.13
99 0.13
100 0.14
101 0.12
102 0.13
103 0.13
104 0.1
105 0.1
106 0.13
107 0.16
108 0.19
109 0.19
110 0.24
111 0.32
112 0.39
113 0.47
114 0.45
115 0.5
116 0.54
117 0.61
118 0.66
119 0.61
120 0.62
121 0.59
122 0.62
123 0.62
124 0.61
125 0.55
126 0.48
127 0.49
128 0.49
129 0.47
130 0.43
131 0.35
132 0.29
133 0.25
134 0.23
135 0.18
136 0.12
137 0.1
138 0.11
139 0.1
140 0.13
141 0.13
142 0.13