Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V9X1

Protein Details
Accession H1V9X1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-33TYASSHPCNQRIRREEKKKKLRTQTRVFGLACHydrophilic
NLS Segment(s)
PositionSequence
14-21RREEKKKK
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 7.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MTYASSHPCNQRIRREEKKKKLRTQTRVFGLACPTGLHFTPQIAYALLSHPSSPLAVAPFSPVNDKPQPAGSRAPPPGSCASSRLDERLVLSCLARLPRHHVRSRDIVGLWGPPMWRRPYDVRQNFASWFIIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.85
4 0.87
5 0.9
6 0.9
7 0.92
8 0.93
9 0.93
10 0.92
11 0.91
12 0.89
13 0.84
14 0.8
15 0.71
16 0.62
17 0.54
18 0.45
19 0.35
20 0.26
21 0.21
22 0.16
23 0.16
24 0.15
25 0.12
26 0.11
27 0.11
28 0.12
29 0.11
30 0.09
31 0.09
32 0.08
33 0.09
34 0.1
35 0.1
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.08
46 0.08
47 0.09
48 0.12
49 0.11
50 0.16
51 0.18
52 0.18
53 0.17
54 0.22
55 0.22
56 0.22
57 0.25
58 0.22
59 0.27
60 0.28
61 0.3
62 0.25
63 0.27
64 0.28
65 0.27
66 0.25
67 0.2
68 0.21
69 0.21
70 0.22
71 0.2
72 0.18
73 0.17
74 0.17
75 0.18
76 0.17
77 0.14
78 0.14
79 0.13
80 0.14
81 0.17
82 0.18
83 0.16
84 0.23
85 0.33
86 0.4
87 0.46
88 0.48
89 0.5
90 0.57
91 0.59
92 0.55
93 0.46
94 0.4
95 0.34
96 0.31
97 0.26
98 0.2
99 0.17
100 0.15
101 0.21
102 0.23
103 0.23
104 0.28
105 0.35
106 0.43
107 0.54
108 0.59
109 0.58
110 0.59
111 0.61
112 0.56
113 0.51