Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6FS78

Protein Details
Accession A0A5N6FS78    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
6-25ACPSAIKSERQKNNRCDKVRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 13.333, nucl 4
Family & Domain DBs
Amino Acid Sequences MLKTPACPSAIKSERQKNNRCDKVRNPNLLGWTNEIDINLFFLMTNSFSCLYREKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.75
4 0.74
5 0.8
6 0.83
7 0.78
8 0.76
9 0.76
10 0.78
11 0.78
12 0.74
13 0.66
14 0.58
15 0.58
16 0.52
17 0.44
18 0.35
19 0.28
20 0.22
21 0.2
22 0.17
23 0.13
24 0.11
25 0.11
26 0.08
27 0.07
28 0.06
29 0.06
30 0.07
31 0.07
32 0.08
33 0.09
34 0.11
35 0.11
36 0.14