Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FFZ5

Protein Details
Accession A0A5N6FFZ5   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-38SDPTEAKERRREQNRLAQRRFRRKYSQQKAIVPQFQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14, nucl 26.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MSSDPTEAKERRREQNRLAQRRFRRKYSQQKAIVPQFQHIHSLSSGYESQGTQPGDAVLPDTPGLVSINPVGGPPDGHHRSLYEVNADLFLDGGEFSSMNNLPASDLDMIPAINGLQPTPAPSEPAMEISNPFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.81
4 0.82
5 0.83
6 0.82
7 0.84
8 0.87
9 0.86
10 0.83
11 0.82
12 0.82
13 0.85
14 0.85
15 0.85
16 0.81
17 0.82
18 0.83
19 0.81
20 0.76
21 0.66
22 0.6
23 0.53
24 0.45
25 0.41
26 0.33
27 0.26
28 0.2
29 0.2
30 0.15
31 0.15
32 0.15
33 0.12
34 0.12
35 0.1
36 0.11
37 0.15
38 0.16
39 0.12
40 0.12
41 0.12
42 0.11
43 0.11
44 0.11
45 0.05
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.04
53 0.05
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.15
63 0.17
64 0.17
65 0.18
66 0.17
67 0.21
68 0.23
69 0.23
70 0.16
71 0.15
72 0.14
73 0.14
74 0.14
75 0.1
76 0.07
77 0.07
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.07
85 0.08
86 0.08
87 0.09
88 0.08
89 0.09
90 0.09
91 0.12
92 0.1
93 0.1
94 0.1
95 0.1
96 0.1
97 0.09
98 0.09
99 0.07
100 0.06
101 0.07
102 0.06
103 0.07
104 0.08
105 0.1
106 0.15
107 0.15
108 0.17
109 0.17
110 0.2
111 0.19
112 0.23
113 0.22
114 0.18