Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FAR2

Protein Details
Accession A0A5N6FAR2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
12-38HSETAQAKAQQRHRRKRGLFKKAAEFWHydrophilic
NLS Segment(s)
PositionSequence
9-33KKRHSETAQAKAQQRHRRKRGLFKK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MSKKSSWVKKRHSETAQAKAQQRHRRKRGLFKKAAEFWRECESEVFLAVQVRKTGQMHILNSSSRSQWLHTLANLTSCFPLPIQETMEDIIPQICERSSDRRGEKASTGNKGTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.75
4 0.71
5 0.7
6 0.68
7 0.72
8 0.72
9 0.75
10 0.77
11 0.77
12 0.81
13 0.82
14 0.86
15 0.87
16 0.88
17 0.86
18 0.81
19 0.81
20 0.78
21 0.76
22 0.7
23 0.6
24 0.52
25 0.49
26 0.44
27 0.35
28 0.28
29 0.24
30 0.19
31 0.18
32 0.15
33 0.09
34 0.11
35 0.11
36 0.11
37 0.1
38 0.1
39 0.12
40 0.12
41 0.12
42 0.16
43 0.19
44 0.19
45 0.21
46 0.22
47 0.2
48 0.21
49 0.22
50 0.16
51 0.14
52 0.14
53 0.13
54 0.14
55 0.18
56 0.17
57 0.17
58 0.19
59 0.17
60 0.2
61 0.19
62 0.17
63 0.14
64 0.13
65 0.13
66 0.1
67 0.13
68 0.11
69 0.13
70 0.14
71 0.14
72 0.15
73 0.15
74 0.16
75 0.14
76 0.12
77 0.11
78 0.09
79 0.09
80 0.09
81 0.08
82 0.1
83 0.13
84 0.21
85 0.25
86 0.34
87 0.38
88 0.44
89 0.48
90 0.49
91 0.51
92 0.52
93 0.55
94 0.53