Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FGN4

Protein Details
Accession A0A5N6FGN4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-79ISTLNTTRKRLPRRSRVLKHAHPPDHydrophilic
NLS Segment(s)
PositionSequence
63-74KRLPRRSRVLKH
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, extr 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006047  Glyco_hydro_13_cat_dom  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00128  Alpha-amylase  
Amino Acid Sequences MNVAKNVLIFTILFDDIPIIYQGQELHFSGAHDPDDREALWLSNYDTNAPLYKLISTLNTTRKRLPRRSRVLKHAHPPDLQRTQRDGPPKGLRRPPDSYGSVDAGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.1
5 0.09
6 0.06
7 0.06
8 0.07
9 0.08
10 0.09
11 0.11
12 0.11
13 0.12
14 0.12
15 0.12
16 0.13
17 0.14
18 0.14
19 0.13
20 0.13
21 0.12
22 0.13
23 0.12
24 0.12
25 0.11
26 0.1
27 0.09
28 0.1
29 0.1
30 0.11
31 0.11
32 0.11
33 0.11
34 0.11
35 0.12
36 0.11
37 0.1
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.14
45 0.22
46 0.27
47 0.3
48 0.36
49 0.44
50 0.51
51 0.6
52 0.65
53 0.67
54 0.73
55 0.81
56 0.82
57 0.84
58 0.85
59 0.82
60 0.81
61 0.79
62 0.74
63 0.66
64 0.63
65 0.62
66 0.62
67 0.58
68 0.53
69 0.51
70 0.49
71 0.51
72 0.55
73 0.5
74 0.49
75 0.56
76 0.6
77 0.63
78 0.67
79 0.69
80 0.67
81 0.7
82 0.66
83 0.62
84 0.57
85 0.52
86 0.49