Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VU69

Protein Details
Accession H1VU69    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25CSRRARPTSPRRRARRTPATTTRCAHydrophilic
92-117WRAGGRSWRTRARRARPRPMARRRASBasic
NLS Segment(s)
PositionSequence
5-16ARPTSPRRRARR
91-117PWRAGGRSWRTRARRARPRPMARRRAS
Subcellular Location(s) nucl 16, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences CSRRARPTSPRRRARRTPATTTRCASPRCRSCCSSAAALRAMCSTSRASSGSAASRAASKACARSSSTCSRARVWVSRRPSRAAARACGWPWRAGGRSWRTRARRARPRPMARRRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.87
4 0.86
5 0.87
6 0.84
7 0.8
8 0.72
9 0.68
10 0.63
11 0.58
12 0.55
13 0.55
14 0.57
15 0.57
16 0.61
17 0.57
18 0.56
19 0.56
20 0.52
21 0.49
22 0.42
23 0.39
24 0.36
25 0.33
26 0.29
27 0.25
28 0.22
29 0.15
30 0.14
31 0.12
32 0.1
33 0.11
34 0.11
35 0.12
36 0.12
37 0.14
38 0.13
39 0.13
40 0.12
41 0.11
42 0.11
43 0.11
44 0.1
45 0.1
46 0.1
47 0.12
48 0.13
49 0.15
50 0.16
51 0.19
52 0.25
53 0.29
54 0.34
55 0.36
56 0.37
57 0.37
58 0.39
59 0.4
60 0.42
61 0.41
62 0.43
63 0.46
64 0.52
65 0.53
66 0.53
67 0.55
68 0.54
69 0.57
70 0.53
71 0.49
72 0.44
73 0.46
74 0.43
75 0.43
76 0.38
77 0.32
78 0.3
79 0.3
80 0.29
81 0.27
82 0.36
83 0.39
84 0.46
85 0.52
86 0.59
87 0.6
88 0.69
89 0.76
90 0.77
91 0.79
92 0.81
93 0.85
94 0.86
95 0.92
96 0.93
97 0.93