Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I7KFW1

Protein Details
Accession I7KFW1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77LAVDREHKRTSRREKRIKSKBasic
NLS Segment(s)
PositionSequence
64-77HKRTSRREKRIKSK
Subcellular Location(s) plas 18, E.R. 5, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGIERRRFHRQLTVFVVIMLASPVAIPVAARWLGLDSPAVSLMSLFLVLGSMGAICKLAVDREHKRTSRREKRIKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.38
4 0.27
5 0.23
6 0.15
7 0.08
8 0.04
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.08
22 0.08
23 0.05
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.06
46 0.09
47 0.17
48 0.25
49 0.33
50 0.42
51 0.46
52 0.52
53 0.61
54 0.69
55 0.73
56 0.77
57 0.8