Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6FW53

Protein Details
Accession A0A5N6FW53    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-37TSTRAPKTRRYACDRCRRQKLKCDVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MMHNVSSGHTGTSTRAPKTRRYACDRCRRQKLKCDVEKPCSLCLRSGFDCVTANSPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.33
4 0.4
5 0.49
6 0.56
7 0.56
8 0.61
9 0.67
10 0.71
11 0.8
12 0.82
13 0.82
14 0.84
15 0.83
16 0.8
17 0.79
18 0.8
19 0.8
20 0.78
21 0.77
22 0.73
23 0.72
24 0.73
25 0.65
26 0.6
27 0.55
28 0.47
29 0.41
30 0.38
31 0.38
32 0.34
33 0.35
34 0.3
35 0.28
36 0.29
37 0.27
38 0.27