Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FIW6

Protein Details
Accession A0A5N6FIW6   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
83-113RALCVKLRGRKIWKKEKPKRKITPPPPYFLCHydrophilic
NLS Segment(s)
PositionSequence
89-104LRGRKIWKKEKPKRKI
Subcellular Location(s) cyto 5.5, cyto_nucl 10.5, nucl 14.5, pero 5
Family & Domain DBs
Amino Acid Sequences MLVKDGDLPNEPCLRKIAFQQPTNCTCVLLQQLRRDTVGASGTGINVTTAEWPAPSFPLRVIPLPPIVSCTHTTIFGTASICRALCVKLRGRKIWKKEKPKRKITPPPPYFLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.34
4 0.39
5 0.4
6 0.46
7 0.51
8 0.55
9 0.56
10 0.57
11 0.5
12 0.41
13 0.32
14 0.3
15 0.3
16 0.3
17 0.31
18 0.35
19 0.39
20 0.39
21 0.39
22 0.36
23 0.29
24 0.24
25 0.21
26 0.14
27 0.11
28 0.1
29 0.1
30 0.09
31 0.09
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.07
42 0.07
43 0.07
44 0.07
45 0.11
46 0.12
47 0.13
48 0.13
49 0.14
50 0.15
51 0.16
52 0.15
53 0.15
54 0.14
55 0.16
56 0.17
57 0.19
58 0.17
59 0.17
60 0.17
61 0.15
62 0.15
63 0.13
64 0.13
65 0.1
66 0.11
67 0.11
68 0.11
69 0.1
70 0.11
71 0.11
72 0.15
73 0.2
74 0.27
75 0.34
76 0.41
77 0.49
78 0.59
79 0.66
80 0.72
81 0.78
82 0.8
83 0.84
84 0.88
85 0.9
86 0.9
87 0.92
88 0.93
89 0.92
90 0.93
91 0.93
92 0.94
93 0.88