Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FG33

Protein Details
Accession A0A5N6FG33   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-39SQPSRNERSKHVPRRTPRSCHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 4, extr 3, mito 4, plas 15
Family & Domain DBs
Amino Acid Sequences MLTPHHPFFIFIFIFIFLGSQPSRNERSKHVPRRTPRSCIVIPLALHPLPIWGNSFSDGDTDESRCWTRRIFGSVRPLRSGAHCAVALRRDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.06
5 0.1
6 0.1
7 0.12
8 0.13
9 0.18
10 0.24
11 0.29
12 0.32
13 0.34
14 0.45
15 0.53
16 0.62
17 0.66
18 0.69
19 0.73
20 0.81
21 0.8
22 0.75
23 0.68
24 0.65
25 0.56
26 0.5
27 0.44
28 0.36
29 0.31
30 0.27
31 0.26
32 0.19
33 0.18
34 0.15
35 0.13
36 0.1
37 0.1
38 0.1
39 0.08
40 0.08
41 0.1
42 0.11
43 0.09
44 0.1
45 0.1
46 0.11
47 0.12
48 0.13
49 0.11
50 0.14
51 0.16
52 0.18
53 0.18
54 0.17
55 0.21
56 0.23
57 0.3
58 0.31
59 0.35
60 0.44
61 0.5
62 0.52
63 0.5
64 0.47
65 0.42
66 0.42
67 0.41
68 0.32
69 0.29
70 0.26
71 0.25
72 0.29