Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7BU14

Protein Details
Accession A0A5N7BU14    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-38KIPWRISAPQKARQRKRLRSVDTVHydrophilic
78-99FDKKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKATSPLLSGLLWKIPWRISAPQKARQRKRLRSVDTVVDTISAALARNGLKARSVDRWYREMPREEEMLPKDKYTLFDKKEKTYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.17
4 0.2
5 0.23
6 0.29
7 0.34
8 0.44
9 0.49
10 0.55
11 0.64
12 0.72
13 0.77
14 0.8
15 0.82
16 0.82
17 0.86
18 0.87
19 0.83
20 0.8
21 0.75
22 0.71
23 0.63
24 0.54
25 0.43
26 0.33
27 0.27
28 0.19
29 0.15
30 0.08
31 0.05
32 0.04
33 0.06
34 0.05
35 0.08
36 0.08
37 0.08
38 0.1
39 0.11
40 0.13
41 0.17
42 0.2
43 0.23
44 0.25
45 0.29
46 0.31
47 0.36
48 0.38
49 0.38
50 0.37
51 0.35
52 0.34
53 0.3
54 0.33
55 0.3
56 0.31
57 0.27
58 0.25
59 0.24
60 0.23
61 0.25
62 0.26
63 0.32
64 0.3
65 0.38
66 0.42
67 0.49
68 0.57
69 0.62
70 0.61
71 0.63
72 0.67
73 0.69
74 0.74
75 0.76
76 0.77
77 0.77
78 0.83
79 0.82
80 0.84
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79