Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W234

Protein Details
Accession H1W234   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
21-41TQQPLGKRWIHRFKQRNPSIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 8.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
IPR006600  HTH_CenpB_DNA-bd_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
PF03221  HTH_Tnp_Tc5  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences SLGCSLTHQQVKGLAERLLGTQQPLGKRWIHRFKQRNPSIITKRPKAMDSRRYKAHSADVIQAWFQRLDNIPVIQGIHPSNRWNMDETGIMEGRGSNGLVLGSAASRAIQKKQPGSRAWVSLIECISAAGSSLPPIVIYKGKSVQAQWFPSDLSPYDGWHFTYLDNGWTTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.24
4 0.25
5 0.23
6 0.21
7 0.18
8 0.18
9 0.21
10 0.23
11 0.24
12 0.26
13 0.28
14 0.34
15 0.43
16 0.51
17 0.55
18 0.63
19 0.71
20 0.77
21 0.83
22 0.82
23 0.79
24 0.74
25 0.76
26 0.74
27 0.74
28 0.73
29 0.67
30 0.65
31 0.6
32 0.58
33 0.57
34 0.58
35 0.59
36 0.6
37 0.61
38 0.63
39 0.64
40 0.63
41 0.56
42 0.53
43 0.47
44 0.4
45 0.38
46 0.32
47 0.29
48 0.28
49 0.26
50 0.21
51 0.16
52 0.14
53 0.12
54 0.11
55 0.13
56 0.14
57 0.14
58 0.13
59 0.13
60 0.14
61 0.11
62 0.12
63 0.11
64 0.11
65 0.11
66 0.13
67 0.14
68 0.15
69 0.16
70 0.16
71 0.16
72 0.15
73 0.15
74 0.15
75 0.15
76 0.13
77 0.12
78 0.1
79 0.09
80 0.08
81 0.08
82 0.07
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.06
94 0.08
95 0.11
96 0.16
97 0.2
98 0.28
99 0.34
100 0.4
101 0.4
102 0.46
103 0.46
104 0.44
105 0.42
106 0.38
107 0.34
108 0.3
109 0.28
110 0.21
111 0.17
112 0.14
113 0.12
114 0.08
115 0.07
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.09
124 0.11
125 0.13
126 0.17
127 0.21
128 0.24
129 0.26
130 0.28
131 0.34
132 0.38
133 0.4
134 0.37
135 0.35
136 0.33
137 0.32
138 0.32
139 0.25
140 0.22
141 0.2
142 0.2
143 0.22
144 0.22
145 0.23
146 0.22
147 0.22
148 0.17
149 0.21
150 0.19
151 0.2